Integrin beta 2/CD18 Recombinant Protein Antigen

Images

 
There are currently no images for Integrin beta 2/CD18 Protein (NBP1-88128PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin beta 2/CD18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGB2.

Source: E.coli

Amino Acid Sequence: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88128.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Integrin beta 2/CD18 Recombinant Protein Antigen

  • 959 beta subunit precursor)10
  • CD18 antigen
  • CD18
  • CD18beta 2
  • cell surface adhesion glycoprotein (LFA-1
  • CR3
  • Integrin beta 2
  • integrin beta-2
  • integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1;macrophage antigen 1 (mac-1) beta subunit)
  • integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
  • ITGB2
  • LAD
  • LCAMB
  • leukocyte cell adhesion molecule CD18
  • leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C
  • LFA-1 beta
  • LFA-1
  • MAC-1 beta
  • MF17
  • MFI7
  • P150
  • p150,95 beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

796-IC
Species: Mu
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-25200
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88128PEP
Species: Hu
Applications: AC

Publications for Integrin beta 2/CD18 Protein (NBP1-88128PEP) (0)

There are no publications for Integrin beta 2/CD18 Protein (NBP1-88128PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 2/CD18 Protein (NBP1-88128PEP) (0)

There are no reviews for Integrin beta 2/CD18 Protein (NBP1-88128PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Integrin beta 2/CD18 Protein (NBP1-88128PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Integrin beta 2/CD18 Protein (NBP1-88128PEP)

Discover related pathways, diseases and genes to Integrin beta 2/CD18 Protein (NBP1-88128PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 2/CD18 Protein (NBP1-88128PEP)

Discover more about diseases related to Integrin beta 2/CD18 Protein (NBP1-88128PEP).
 

Pathways for Integrin beta 2/CD18 Protein (NBP1-88128PEP)

View related products by pathway.

PTMs for Integrin beta 2/CD18 Protein (NBP1-88128PEP)

Learn more about PTMs related to Integrin beta 2/CD18 Protein (NBP1-88128PEP).
 

Research Areas for Integrin beta 2/CD18 Protein (NBP1-88128PEP)

Find related products by research area.

Blogs on Integrin beta 2/CD18.

CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies
The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin beta 2/CD18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB2
Entrez