Integrin beta 1/CD29 Recombinant Protein Antigen

Images

 
There are currently no images for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin beta 1/CD29 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGB1.

Source: E. coli

Amino Acid Sequence: KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62630.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin beta 1/CD29 Recombinant Protein Antigen

  • CD29 antigen
  • CD29
  • Fibronectin receptor subunit beta
  • FNRBVLAB
  • GPIIA
  • Integrin beta 1
  • integrin beta-1
  • integrin VLA-4 beta subunit
  • integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12)
  • ITGB1
  • MDF2
  • MSK12
  • very late activation protein, beta polypeptide
  • VLA-4 subunit beta
  • VLA-BETA

Background

Integrin beta-1 (ITGB1, CD29, VLA-beta) is the beta subunit found in the integrin families, forming a heterodimer integrin receptor through non-covalent bonding with various integrin alpha subunits. Integrin heterodimer containing Integrin beta-1 binds to various cell surface and extracellular proteins (CD49a-f, CD51) to mediate cell to cell and cell to matrix adhesion (1). Integrin beta-1 plays a critical role in the cell adhesion and recognition in embryogenesis, hemostasis, immune response, tissue repair, metastatic diffusion of tumor cells and development (2, 3, 4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
AF796
Species: Mu
Applications: AdBlk, IHC, WB
AF4117
Species: Rt
Applications: IHC, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-77333
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF2067
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
202-IL
Species: Hu
Applications: BA

Publications for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP) (0)

There are no publications for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP) (0)

There are no reviews for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.
    • I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.

Additional Integrin beta 1/CD29 Products

Research Areas for Integrin beta 1/CD29 Recombinant Protein Antigen (NBP2-62630PEP)

Find related products by research area.

Blogs on Integrin beta 1/CD29.

Integrin Beta 1/CD29 - a cell adhesion and cell signaling protein with diverse functions
Integrins are a large family of trasmembrane proteins involved in cell adhesion and form a link between the intracellular cyskeletal proteins and extracellular matrix proteins. Integrins exist as heterodimers consisting of alpha and beta subunits. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin beta 1/CD29 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB1