Integrin alpha 6/CD49f Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85748] - Staining in human placenta and tonsil tissues using anti-ITGA6 antibody. Corresponding ITGA6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85748] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85748] - Staining of human placenta shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha 6/CD49f Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Integrin alpha 6/CD49f Protein (NBP1-85748PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha 6/CD49f Antibody - BSA Free

• CD49 antigen-like family member F
• CD49f antigen
• CD49f
• DKFZp686J01244
• FLJ18737
• Integrin alpha 6
• integrin alpha-6
• integrin alpha6B
• integrin, alpha 6
• ITGA6
• ITGA6B
• Platelet gpl
• VLA-6

Background

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA6
• Entrez:
  • 3655(Human)
• Uniprot:
  • P23229()