Integrin alpha 5/CD49e Antibody (8F2O6)

Images

 
Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: ...read more
Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of A-549 cells, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat ...read more
Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: ...read more
Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and K-562 cells were intracellularly-stained with Integrin alpha 5/CD49e ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Integrin alpha 5/CD49e Rabbit mAb at a ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a ...read more
Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Human placenta using Integrin alpha 5/CD49e Rabbit mAb followed by a ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a ...read more
Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Rat large intestine using Integrin alpha 5/CD49e Rabbit mAb followed by ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of ...read more
Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-87MG cells were intracellularly-stained with Integrin alpha 5/CD49e ...read more
Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Flow, ICC/IF, IHC
Clone
8F2O6
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 5/CD49e Antibody (8F2O6) Summary

Description
Novus Biologicals Rabbit Integrin alpha 5/CD49e Antibody (8F2O6) (NBP3-15645) is a recombinant monoclonal antibody validated for use in IHC, WB, Flow and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ITGA5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry 1:50 - 1:200
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Integrin alpha 5/CD49e Antibody (8F2O6)

  • CD49 antigen-like family member E
  • CD49e antigen
  • CD49e
  • Fibronectin receptor subunit alpha
  • fibronectin receptor, alpha subunit
  • FNRAVLA5A
  • Integrin alpha 5
  • integrin alpha-5
  • Integrin alpha-F
  • integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
  • ITGA5
  • very late activation protein 5, alpha subunit
  • VLA-5 alpha
  • VLA-5

Background

CD49e is a type I integral membrane glycoprotein, known as alpha5 integrin, VLA-5 alpha chain. It forms noncovalent heterodimer with integrin beta1 (CD29). CD49e contains two disulfide-linked subunits of 135 kDa and 24 kDa, and is mainly expressed on thymocytes, activated lymphocytes, endothelial cells, osteoblasts, melanoma, and some myeloid leukemia cells. CD49e/CD29 complex binds to fibronection and neural adhesion molecule L1. It mediates monocytes migration, involves in the regulation of cells survival and apoptosis, and co-stimulates T cell activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-77333
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
M6000B
Species: Mu
Applications: ELISA
AF5676
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for Integrin alpha 5/CD49e Antibody (NBP3-15645) (0)

There are no publications for Integrin alpha 5/CD49e Antibody (NBP3-15645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 5/CD49e Antibody (NBP3-15645) (0)

There are no reviews for Integrin alpha 5/CD49e Antibody (NBP3-15645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 5/CD49e Antibody (NBP3-15645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 5/CD49e Products

Research Areas for Integrin alpha 5/CD49e Antibody (NBP3-15645)

Find related products by research area.

Blogs on Integrin alpha 5/CD49e

There are no specific blogs for Integrin alpha 5/CD49e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 5/CD49e Antibody (8F2O6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA5