Integrin alpha 5/CD49e Antibody (8F2O6)

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of A-549 cells, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and K-562 cells were intracellularly-stained with Integrin alpha 5/CD49e Rabbit mAb or Rabbit IgG isotype control ,followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control .

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Human placenta using Integrin alpha 5/CD49e Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Rat large intestine using Integrin alpha 5/CD49e Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-87MG cells were intracellularly-stained with Integrin alpha 5/CD49e Rabbit mAb or Rabbit IgG isotype control ,followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control .

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Flow, ICC/IF, IHC
• Clone: 8F2O6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Integrin alpha 5/CD49e Antibody (8F2O6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ITGA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry 1:50 - 1:200
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Integrin alpha 5/CD49e Antibody (8F2O6)

• CD49 antigen-like family member E
• CD49e antigen
• CD49e
• Fibronectin receptor subunit alpha
• fibronectin receptor, alpha subunit
• FNRAVLA5A
• Integrin alpha 5
• integrin alpha-5
• Integrin alpha-F
• integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
• ITGA5
• very late activation protein 5, alpha subunit
• VLA-5 alpha
• VLA-5

Background

CD49e is a type I integral membrane glycoprotein, known as alpha5 integrin, VLA-5 alpha chain. It forms noncovalent heterodimer with integrin beta1 (CD29). CD49e contains two disulfide-linked subunits of 135 kDa and 24 kDa, and is mainly expressed on thymocytes, activated lymphocytes, endothelial cells, osteoblasts, melanoma, and some myeloid leukemia cells. CD49e/CD29 complex binds to fibronection and neural adhesion molecule L1. It mediates monocytes migration, involves in the regulation of cells survival and apoptosis, and co-stimulates T cell activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA5