Integrin alpha 3B Antibody (PB36) [DyLight 550]

Images

 
There are currently no images for Integrin alpha 3B Antibody (NBP1-97731R).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr
Clone
PB36
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 550

Integrin alpha 3B Antibody (PB36) [DyLight 550] Summary

Immunogen
Clone PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Specificity
PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA3
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Human. A broad species reactivity is expected based on the conserved nature of the epitope.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Integrin alpha 3B Antibody (PB36) [DyLight 550]

  • AA407068
  • CD49C
  • GAPB3
  • integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84576
Species: Hu, Mu
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
BBA37
Species: Hu
Applications: AdBlk
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB2528
Species: Hu
Applications: Flow, IP, AdBlk, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt, Bv, ChHa
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Single Cell Western

Publications for Integrin alpha 3B Antibody (NBP1-97731R) (0)

There are no publications for Integrin alpha 3B Antibody (NBP1-97731R).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3B Antibody (NBP1-97731R) (0)

There are no reviews for Integrin alpha 3B Antibody (NBP1-97731R). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 3B Antibody (NBP1-97731R) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP1-97731AF350
Alexa Fluor 405 NBP1-97731AF405
Alexa Fluor 488 NBP1-97731AF488
Alexa Fluor 532 NBP1-97731AF532
Alexa Fluor 594 NBP1-97731AF594
Alexa Fluor 647 NBP1-97731AF647
Alexa Fluor 700 NBP1-97731AF700
Alexa Fluor 750 NBP1-97731AF750
DyLight 350 NBP1-97731UV
DyLight 405 NBP1-97731V
DyLight 488 NBP1-97731G
DyLight 550 NBP1-97731R
DyLight 594 NBP1-97731DL594
DyLight 650 NBP1-97731C
DyLight 680 NBP1-97731FR
DyLight 755 NBP1-97731IR
Janelia Fluor 549 NBP1-97731JF549
Janelia Fluor 646 NBP1-97731JF646

Additional Integrin alpha 3B Products

Array NBP1-97731R

Bioinformatics Tool for Integrin alpha 3B Antibody (NBP1-97731R)

Discover related pathways, diseases and genes to Integrin alpha 3B Antibody (NBP1-97731R). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 3B Antibody (NBP1-97731R)

Discover more about diseases related to Integrin alpha 3B Antibody (NBP1-97731R).
 

Pathways for Integrin alpha 3B Antibody (NBP1-97731R)

View related products by pathway.

PTMs for Integrin alpha 3B Antibody (NBP1-97731R)

Learn more about PTMs related to Integrin alpha 3B Antibody (NBP1-97731R).

Blogs on Integrin alpha 3B

There are no specific blogs for Integrin alpha 3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3B Antibody (PB36) [DyLight 550] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3