Integrin alpha 3B Antibody (PB36) [DyLight 650]

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: PB36
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: DyLight 650

Integrin alpha 3B Antibody (PB36) [DyLight 650] Summary

• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody recognizes the cytoplasmic domain of integrin subunits Integrin alpha 3B and Integrin alpha 6B. It reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined..

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein A or G purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Integrin alpha 3B Antibody (PB36) [DyLight 650]

• AA407068
• CD49C
• GAPB3
• integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3