Integrin alpha 3B Antibody (PB36) [PE] Summary
| Description |
This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet. |
| Immunogen |
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
| Specificity |
This antibody recognizes the cytoplasmic domain of integrin subunits Integrin alpha 3B and Integrin alpha 6B. It reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. |
| Isotype |
IgG1 |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ITGA3 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Frozen
- Western Blot
|
| Application Notes |
. |
Reactivity Notes
A broad species reactivity is expected based on the conserved nature of the epitope.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A or G purified |
Alternate Names for Integrin alpha 3B Antibody (PB36) [PE]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for Integrin alpha 3B Antibody (NBP1-97731PE) (0)
There are no publications for Integrin alpha 3B Antibody (NBP1-97731PE).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin alpha 3B Antibody (NBP1-97731PE) (0)
There are no reviews for Integrin alpha 3B Antibody (NBP1-97731PE).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin alpha 3B Antibody (NBP1-97731PE) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin alpha 3B Products
Blogs on Integrin alpha 3B