Integrin alpha 3B Antibody (PB36) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Integrin alpha 3B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-97731PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Integrin alpha 3B Antibody (PB36) [PE] Summary

Immunogen
Clone PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Specificity
PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA3
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Reactivity Notes

Human. A broad species reactivity is expected based on the conserved nature of the epitope.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes

This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Integrin alpha 3B Antibody (PB36) [PE]

  • AA407068
  • CD49C
  • GAPB3
  • integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
BBA37
Species: Hu
Applications: AdBlk
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 3B Antibody (NBP1-97731PE) (0)

There are no publications for Integrin alpha 3B Antibody (NBP1-97731PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3B Antibody (NBP1-97731PE) (0)

There are no reviews for Integrin alpha 3B Antibody (NBP1-97731PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Integrin alpha 3B Antibody (NBP1-97731PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

DyLight 350 Labeled NBP1-97731UV
DyLight 405 Labeled NBP1-97731V
DyLight 488 Labeled NBP1-97731G
DyLight 680 Labeled NBP1-97731FR
DyLight 755 Labeled NBP1-97731IR

Additional Integrin alpha 3B Products

Integrin alpha 3B NBP1-97731PE

Bioinformatics Tool for Integrin alpha 3B Antibody (NBP1-97731PE)

Discover related pathways, diseases and genes to Integrin alpha 3B Antibody (NBP1-97731PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 3B Antibody (NBP1-97731PE)

Discover more about diseases related to Integrin alpha 3B Antibody (NBP1-97731PE).
 

Pathways for Integrin alpha 3B Antibody (NBP1-97731PE)

View related products by pathway.

PTMs for Integrin alpha 3B Antibody (NBP1-97731PE)

Learn more about PTMs related to Integrin alpha 3B Antibody (NBP1-97731PE).

Blogs on Integrin alpha 3B

There are no specific blogs for Integrin alpha 3B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3B Antibody (PB36) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3