Integrin alpha 3/CD49c Antibody (158A3) - BSA Free

Immunohistochemistry-Frozen: Integrin alpha 3/CD49c Antibody (158A3) [NBP1-97691] - Frozen sections of dog skin.

Immunohistochemistry-Frozen: Integrin alpha 3/CD49c Antibody (158A3) [NBP1-97691] - Frozen section of human skin

• Reactivity: Hu, Ca
• Applications: WB, ICC/IF, IHC
• Clone: 158A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Integrin alpha 3/CD49c Antibody (158A3) - BSA Free Summary

• Description: The antibody is shipped at ambient temperature and may be stored at 4C. For prolonged storage prepare appropriate aliquots and store at or below -20C. Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2). Repeated thawing and freezing should be avoided. Working dilutions should be stored at 4C, not refrozen, and preferably used the same day. If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance or the concentration of the product.
• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin alpha 3/CD49c.
• Isotype: IgG2a
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:100-1:200
  • Western Blot 1:100-1:1000
• Application Notes: This antibody is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration..

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A or G purified

Alternate Names for Integrin alpha 3/CD49c Antibody (158A3) - BSA Free

• antigen identified by monoclonal J143
• CD49 antigen-like family member C
• CD49c antigen
• CD49c
• FLJ34631
• FLJ34704
• FRP-2
• Galactoprotein B3
• GAP-B3
• GAPB3CD49C
• Integrin alpha 3
• integrin alpha-3
• integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
• ITGA3
• MSK18
• VCA-2
• very late activation protein 3 receptor, alpha-3 subunit
• VL3A
• VLA-3 subunit alpha
• VLA3a

Background

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3