Integrin alpha 3/CD49c Antibody (158A3) [Alexa Fluor™ Plus 647] Summary
| Immunogen |
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Specificity |
This antibody reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin alpha 3/CD49c. |
| Isotype |
IgG2a |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ITGA3 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Frozen
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
A broad species reactivity is expected based on the conserved nature of the epitope.
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A or G purified |
Notes
This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for Integrin alpha 3/CD49c Antibody (158A3) [Alexa Fluor™ Plus 647]
Background
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu, Ca
Applications: WB, ICC/IF, IHC
Publications for Integrin alpha 3/CD49c Antibody (NBP1-97691AFP647) (0)
There are no publications for Integrin alpha 3/CD49c Antibody (NBP1-97691AFP647).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin alpha 3/CD49c Antibody (NBP1-97691AFP647) (0)
There are no reviews for Integrin alpha 3/CD49c Antibody (NBP1-97691AFP647).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin alpha 3/CD49c Antibody (NBP1-97691AFP647) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin alpha 3/CD49c Products
Blogs on Integrin alpha 3/CD49c