INSRR/IR-related receptor Antibody (2C1)

Images

 
Sandwich ELISA: INSRR/IR-related receptor Antibody (2C1) [H00003645-M03] - Detection limit for recombinant GST tagged INSRR is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

INSRR/IR-related receptor Antibody (2C1) Summary

Immunogen
INSRR (NP_055030 651 a.a. - 760 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF
Localization
Cell Membrane; single-pass type I membrane protein.
Specificity
INSRR - insulin receptor-related receptor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INSRR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INSRR/IR-related receptor Antibody (2C1)

  • EC 2.7.10
  • EC 2.7.10.1
  • INSRR
  • insulin receptor-related protein
  • insulin receptor-related receptor
  • IRR
  • IRRIR-related receptor

Background

The insulin receptor related receptor (IRR) is a heterotetrameric transmembrane receptor composed of two alpha and 2 beta chains linked by disulfide bonds. The alpha chains contribute to the formation of the ligand-binding domain, while the beta chains carry the kinase domain. Member of the insulin RTK family, IRR shares high homology with the insulin (IR) and the insulin-like growth factor-1 receptor (IGF-1R), but doesn’t bind any of IR and IGF-1R known ligands. In contrast to the widespread patterns of expression to IR and IGF-1R, IRR demonstrates a very restricted cellular distribution in a subset of tissues of neuronal origin and its biological functions are still unknown. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The tyrosine kinase (TK) group is mainly involved in the regulation of cell-cell interactions such as differentiation, adhesion, motility and death. There are currently about 90 TK genes sequenced, 58 are of receptor protein TK (e.g. EGFR, EPH, FGFR, PDGFR, TRK, and VEGFR families), and 32 of cytosolic TK (e.g. ABL, FAK, JAK, and SRC families).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12793
Species: Hu, Mu
Applications: WB, IP
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6347
Species: Hu
Applications: WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for INSRR/IR-related receptor Antibody (H00003645-M03) (0)

There are no publications for INSRR/IR-related receptor Antibody (H00003645-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSRR/IR-related receptor Antibody (H00003645-M03) (0)

There are no reviews for INSRR/IR-related receptor Antibody (H00003645-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSRR/IR-related receptor Antibody (H00003645-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSRR/IR-related receptor Products

Bioinformatics Tool for INSRR/IR-related receptor Antibody (H00003645-M03)

Discover related pathways, diseases and genes to INSRR/IR-related receptor Antibody (H00003645-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSRR/IR-related receptor Antibody (H00003645-M03)

Discover more about diseases related to INSRR/IR-related receptor Antibody (H00003645-M03).
 

Pathways for INSRR/IR-related receptor Antibody (H00003645-M03)

View related products by pathway.

PTMs for INSRR/IR-related receptor Antibody (H00003645-M03)

Learn more about PTMs related to INSRR/IR-related receptor Antibody (H00003645-M03).
 

Research Areas for INSRR/IR-related receptor Antibody (H00003645-M03)

Find related products by research area.

Blogs on INSRR/IR-related receptor

There are no specific blogs for INSRR/IR-related receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INSRR/IR-related receptor Antibody (2C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol INSRR
Entrez
OMIM
Uniprot