INSC Antibody

Images

 
Immunohistochemistry: INSC Antibody [NBP1-90980] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INSC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INSC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INSC Protein (NBP1-90980PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INSC Antibody

  • inscuteable homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF755
Species: Mu
Applications: WB, Block
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP1-33202
Species: Hu, Mu
Applications: WB, IP
MAB2476
Species: Hu
Applications: WB, IHC
AF4036
Species: Hu
Applications: WB, Simple Western
MAB7447
Species: Hu
Applications: WB, IHC
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-56902
Species: Hu
Applications: WB, ICC/IF

Publications for INSC Antibody (NBP1-90980) (0)

There are no publications for INSC Antibody (NBP1-90980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSC Antibody (NBP1-90980) (0)

There are no reviews for INSC Antibody (NBP1-90980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INSC Antibody (NBP1-90980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSC Products

INSC NBP1-90980

Bioinformatics Tool for INSC Antibody (NBP1-90980)

Discover related pathways, diseases and genes to INSC Antibody (NBP1-90980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSC Antibody (NBP1-90980)

Discover more about diseases related to INSC Antibody (NBP1-90980).
 

Pathways for INSC Antibody (NBP1-90980)

View related products by pathway.

PTMs for INSC Antibody (NBP1-90980)

Learn more about PTMs related to INSC Antibody (NBP1-90980).

Blogs on INSC

There are no specific blogs for INSC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INSC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INSC