Inositol Monophosphatase 3/IMPAD1 Antibody

Images

 
Western Blot: IMPAD1 Antibody [NBP1-59473] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Inositol Monophosphatase 3/IMPAD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the N terminal of IMPAD1. Peptide sequence VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL.
Clonality
Polyclonal
Host
Rabbit
Gene
IMPAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IMPAD1 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Inositol Monophosphatase 3/IMPAD1 Antibody

  • EC 3.1.3
  • EC 3.1.3.25
  • FLJ20421
  • IMP 3
  • IMP3
  • IMPA3
  • IMPA3IMPase 3
  • IMPase 3
  • inositol monophosphatase 3
  • Inositol Monophosphatase 3/IMPAD1
  • inositol monophosphatase domain containing 1
  • Inositol monophosphatase domain-containing protein 1
  • Inositol-1(or 4)-monophosphatase 3
  • Myo-inositol monophosphatase A3

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57229
Species: Hu
Applications: WB, IHC
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59510
Species: Hu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87345
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24643
Species: Mu
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-59473
Species: Hu
Applications: WB

Publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inositol Monophosphatase 3/IMPAD1 Products

Related Products by Gene

Bioinformatics Tool for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Discover related pathways, diseases and genes to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Discover more about diseases related to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473).
 

Pathways for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

View related products by pathway.

Research Areas for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Find related products by research area.

Blogs on Inositol Monophosphatase 3/IMPAD1

There are no specific blogs for Inositol Monophosphatase 3/IMPAD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol IMPAD1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59473 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought