Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)


Western Blot: IMPAD1 Antibody [NBP1-59473] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Inositol Monophosphatase 3/IMPAD1 Antibody Summary

Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the N terminal of IMPAD1. Peptide sequence VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IMPAD1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Inositol Monophosphatase 3/IMPAD1 Antibody

  • EC 3.1.3
  • EC
  • FLJ20421
  • IMP 3
  • IMP3
  • IMPA3
  • IMPA3IMPase 3
  • IMPAD1
  • IMPase 3
  • inositol monophosphatase 3
  • inositol monophosphatase domain containing 1
  • Inositol monophosphatase domain-containing protein 1
  • Inositol-1(or 4)-monophosphatase 3
  • Myo-inositol monophosphatase A3


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu
Applications: WB

Publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Inositol Monophosphatase 3/IMPAD1 Products

Related Products by Gene

Bioinformatics Tool for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Discover related pathways, diseases and genes to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Discover more about diseases related to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473).

Pathways for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

View related products by pathway.

Research Areas for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-59473)

Find related products by research area.

Blogs on Inositol Monophosphatase 3/IMPAD1

There are no specific blogs for Inositol Monophosphatase 3/IMPAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Inositol Monophosphatase 3/IMPAD1 Antibody and receive a gift card or discount.


Gene Symbol IMPAD1