Inorganic Pyrophosphatase/PPA1 Antibody

Images

 
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-87788] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-87788] - Staining of human testis shows cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-87788] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Inorganic Pyrophosphatase/PPA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Inorganic Pyrophosphatase/PPA1 Protein (NBP1-87788PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Inorganic Pyrophosphatase/PPA1 Antibody

  • diphosphate phosphohydrolase
  • EC 3.6.1.1
  • inorganic diphosphatase
  • inorganic pyrophosphatase 1
  • inorganic pyrophosphatase
  • IOPPP
  • IOPPPMGC111556
  • IPP1
  • PP1
  • PPA1
  • PPase
  • PPcytosolic inorganic pyrophosphatase
  • pyrophosphatase (inorganic) 1
  • pyrophosphatase (inorganic)
  • pyrophosphatase 1
  • Pyrophosphate phospho-hydrolase
  • SID6-8061

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87788
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788) (0)

There are no publications for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788) (0)

There are no reviews for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inorganic Pyrophosphatase/PPA1 Products

Bioinformatics Tool for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788)

Discover related pathways, diseases and genes to Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788)

Discover more about diseases related to Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788).
 

Pathways for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788)

View related products by pathway.

PTMs for Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788)

Learn more about PTMs related to Inorganic Pyrophosphatase/PPA1 Antibody (NBP1-87788).

Blogs on Inorganic Pyrophosphatase/PPA1

There are no specific blogs for Inorganic Pyrophosphatase/PPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Inorganic Pyrophosphatase/PPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPA1
Entrez