Inhibin alpha Recombinant Protein Antigen

Images

 
There are currently no images for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Inhibin alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INHA.

Source: E. coli

Amino Acid Sequence: QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INHA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87563.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Inhibin alpha Recombinant Protein Antigen

  • A-inhibin subunit
  • INHA
  • Inhibin A
  • inhibin alpha chain
  • inhibin, alpha

Background

INHA(A-inhibin subunit precursor, inhibin alpha subunit ),also called inhibin(alpha) ,which is located on chromosome 2q33-q36. Inhibin is a gonadal protein that preferentially suppresses the secretion of pituitary follicle-stimulating hormone (FSH). Inhibin comprises of two subunits,Inhibin A and B. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa cell tumors and can therefore be used as a marker for primary as well as recurrent disease. In addition to their role in endocrine feedback in the reproductive sytem, inhibins subserve local regulatory roles in numerous extragonadal tissues, including brain, adrenal,bone marrow, placenta, and most notably anterior pituitary. Inhibin alpha subunit gene expression is down regulated in human prostate cancer, suggesting a tumor suppressive role.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-52553
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-79413
Species: Hu
Applications: WB
NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
NBP3-03329
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
338-AC
Species: Hu, Mu, Rt
Applications: BA
NBP2-26096
Species: Bv, Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-24689
Species: Hu, Mu
Applications: WB
DFN00
Species: Hu
Applications: ELISA
NBP2-36489
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB

Publications for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP) (0)

There are no publications for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP) (0)

There are no reviews for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Inhibin alpha Products

Research Areas for Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP)

Find related products by research area.

Blogs on Inhibin alpha

There are no specific blogs for Inhibin alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Inhibin alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INHA