INHBE Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit INHBE Antibody - Azide and BSA Free (H00083729-D01P) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
INHBE (NP_113667.1, 1 a.a. - 350 a.a.) full-length human protein. MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
INHBE |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunoprecipitation
- Western Blot 1:100-1:2000
|
| Application Notes |
This antibody is useful for Western Blot |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for INHBE Antibody - Azide and BSA Free
Background
INHBE is a member of the activin beta family (see INHBA; MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for INHBE Antibody (H00083729-D01P) (0)
There are no publications for INHBE Antibody (H00083729-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for INHBE Antibody (H00083729-D01P) (0)
There are no reviews for INHBE Antibody (H00083729-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for INHBE Antibody (H00083729-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional INHBE Products
Blogs on INHBE