![Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in mouse liver.](http://images.novusbio.com/fullsize/INHBE-Antibody-Western-Blot-H00083729-D01P-img0007.jpg "Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in mouse liver.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit INHBE Antibody - Azide and BSA Free (H00083729-D01P) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | INHBE (NP_113667.1, 1 a.a. - 350 a.a.) full-length human protein. MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | INHBE |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | INHBE |
| Uniprot |
|
![Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in human liver.](http://images.novusbio.com/fullsize/INHBE-Antibody-Western-Blot-H00083729-D01P-img0006.jpg "Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in human liver.")
![Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in transfected 293T cell line by INHBE polyclonal antibody.Lane 1: INHBE transfected lysate(38.60 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/INHBE-Antibody-Western-Blot-H00083729-D01P-img0008.jpg "Western Blot: INHBE Antibody [H00083729-D01P] - Analysis of INHBE expression in transfected 293T cell line by INHBE polyclonal antibody.Lane 1: INHBE transfected lysate(38.60 KDa).Lane 2: Non-transfected lysate.")
![Immunoprecipitation: INHBE Antibody [H00083729-D01P] - Analysis of INHBE transfected lysate using anti-INHBE rabbit polyclonal antibody and Protein Magnetic Bead, and immunoblotted with INHBE purified mouse polyclonal antibody (B02P).](http://images.novusbio.com/fullsize/INHBE-Antibody-Immunoprecipitation-H00083729-D01P-img0005.jpg "Immunoprecipitation: INHBE Antibody [H00083729-D01P] - Analysis of INHBE transfected lysate using anti-INHBE rabbit polyclonal antibody and Protein Magnetic Bead, and immunoblotted with INHBE purified mouse polyclonal antibody (B02P).")
![Activin C/Inhibin beta C Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Activin C/Inhibin beta C Antibody [Unconjugated]")
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_22497.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_9765.jpg)
![SDS-PAGE TGF-beta 2 [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_2_302-B2_268.jpg)
![Bioactivity TGF-beta 2 [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_2_302-B2_269.jpg)
![Surface Plasmon Resonance (SPR) TGF-beta 2 [Unconjugated]](https://images.novusbio.com/images/302-b2_recombinant-human-tgf-beta-2-protein-surface-plasmon-resonance-spr-144202585019..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")