IMPG2 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye, retina, kidney, liver and pancreas using Anti-IMPG2 antibody NBP2-54954 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye retina shows strong cytoplasmic positivity in rodes and cones cells.
Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

IMPG2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
Use in IHC-FR reported in scientific literature (PMID:35024589).For IHC-Paraffin, HIER pH 6 retrieval is recommended..
Control Peptide
IMPG2 Recombinant Protein Antigen (NBP2-54954PEP)
Publications
Read Publication using
NBP2-54954 in the following applications:

Reactivity Notes

Use in Monkey reported in scientific literature (PMID:35024589) .

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IMPG2 Antibody

  • interphotoreceptor matrix proteoglycan 2
  • interphotoreceptor matrix proteoglycan 200
  • Interphotoreceptor matrix proteoglycan of 200 kDa
  • IPM 200
  • IPM200SPACRCAN
  • RP56
  • Sialoprotein associated with cones and rods proteoglycan
  • Spacrcan

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57460
Species: Hu
Applications: IHC, IHC-P
236-EG
Species: Hu
Applications: BA
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF5665
Species: Mu, Rt
Applications: IHC, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, Simple Western, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-38213
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for IMPG2 Antibody (NBP2-54954)(1)

We have publications tested in 1 confirmed species: Monkey.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Monkey
(1)
All Species

Reviews for IMPG2 Antibody (NBP2-54954) (0)

There are no reviews for IMPG2 Antibody (NBP2-54954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IMPG2 Antibody (NBP2-54954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMPG2 Products

Array NBP2-54954

Bioinformatics Tool for IMPG2 Antibody (NBP2-54954)

Discover related pathways, diseases and genes to IMPG2 Antibody (NBP2-54954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPG2 Antibody (NBP2-54954)

Discover more about diseases related to IMPG2 Antibody (NBP2-54954).
 

Pathways for IMPG2 Antibody (NBP2-54954)

View related products by pathway.

PTMs for IMPG2 Antibody (NBP2-54954)

Learn more about PTMs related to IMPG2 Antibody (NBP2-54954).
 

Research Areas for IMPG2 Antibody (NBP2-54954)

Find related products by research area.

Blogs on IMPG2

There are no specific blogs for IMPG2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMPG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPG2