IMPDH1 Antibody

Images

 
Western Blot: IMPDH1 Antibody [H00003614-B01P] - Analysis of IMPDH1 expression in human spleen.
Western Blot: IMPDH1 Antibody [H00003614-B01P] - Analysis of IMPDH1 expression in transfected 293T cell line by IMPDH1 polyclonal antibody. Lane1:IMPDH1 transfected lysate(61.93 KDa). Lane2:Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IMPDH1 Antibody Summary

Immunogen
IMPDH1 (NP_899066.1, 1 a.a. - 563 a.a.) full-length human protein. MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IMPDH1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IMPDH1 Antibody

  • DKFZp781N0678
  • EC 1.1.1.205
  • IMP (inosine 5'-monophosphate) dehydrogenase 1
  • IMP (inosine monophosphate) dehydrogenase 1
  • IMP Dehydrogenase 1
  • IMPD 1
  • IMPD
  • IMPD1
  • IMPDH 1
  • IMPDH1
  • IMPDH-I
  • inosine-5'-monophosphate dehydrogenase 1
  • LCA11
  • LCA11RP10
  • retinitis pigmentosa 10 (autosomal dominant)
  • RP10
  • sWSS2608

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86177
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2945
Species: Hu
Applications: WB
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP2-58068
Species: Hu
Applications: ICC/IF, IHC-P

Publications for IMPDH1 Antibody (H00003614-B01P) (0)

There are no publications for IMPDH1 Antibody (H00003614-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMPDH1 Antibody (H00003614-B01P) (0)

There are no reviews for IMPDH1 Antibody (H00003614-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IMPDH1 Antibody (H00003614-B01P). (Showing 1 - 1 of 1 FAQ).

  1. Do you have a kit for measuring IMPDH activity?
    • We currently do not have any kits to measure IMPDH activity, however we have a number of IMPDH antibody pairs that can be used for WB/IP and ELISA.

Secondary Antibodies

 

Isotype Controls

Additional IMPDH1 Products

Bioinformatics Tool for IMPDH1 Antibody (H00003614-B01P)

Discover related pathways, diseases and genes to IMPDH1 Antibody (H00003614-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPDH1 Antibody (H00003614-B01P)

Discover more about diseases related to IMPDH1 Antibody (H00003614-B01P).
 

Pathways for IMPDH1 Antibody (H00003614-B01P)

View related products by pathway.

PTMs for IMPDH1 Antibody (H00003614-B01P)

Learn more about PTMs related to IMPDH1 Antibody (H00003614-B01P).

Blogs on IMPDH1

There are no specific blogs for IMPDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMPDH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPDH1
Entrez
Uniprot