We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

IMPA2 Recombinant Protein Antigen

Images

 
There are currently no images for IMPA2 Protein (NBP1-86352PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IMPA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IMPA2.

Source: E. coli

Amino Acid Sequence: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IMPA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86352.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IMPA2 Recombinant Protein Antigen

  • EC 3.1.3.25
  • IMP 2
  • IMP.18P
  • IMPase 2
  • inosine monophosphatase 2
  • inositol monophosphatase 2 variant 1
  • inositol monophosphatase 2 variant 2
  • inositol monophosphatase 2
  • inositol(myo)-1(or 4)-monophosphatase 2
  • Inositol-1(or 4)-monophosphatase 2
  • Myo-inositol monophosphatase A2

Background

IMPA2, also known as Inositol monophosphatase 2, has a 288 amino acid isoform that is 31 kDa and a short 261 amino acid that is 29 kDa, catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling, can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates, and serves as possible pharmacological target for lithium Li+ action in brain. Studies are being performed on the relationship of this protein to bipolar disorder, mood disorder, seizures, schizophrenia, febrile seizures, bipolar affective disorder, neisseria meningitides, pneumonia, tuberculosis, neuronitis, schizophrenia and leukemia. The protein has been shown to interact with HERPUD1, TNFRSF1H, INPP1, ISYNA1, and PLCG1 in inositol phosphate metabolism, metabolic pathways and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83107
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-32225
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, IP, KO, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14040
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
201-LB
Species: Hu
Applications: BA
DFN00
Species: Hu
Applications: ELISA
AF5129
Species: Hu
Applications: WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP1-89559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86352PEP
Species: Hu
Applications: AC

Publications for IMPA2 Protein (NBP1-86352PEP) (0)

There are no publications for IMPA2 Protein (NBP1-86352PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMPA2 Protein (NBP1-86352PEP) (0)

There are no reviews for IMPA2 Protein (NBP1-86352PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IMPA2 Protein (NBP1-86352PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IMPA2 Products

Research Areas for IMPA2 Protein (NBP1-86352PEP)

Find related products by research area.

Blogs on IMPA2

There are no specific blogs for IMPA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IMPA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPA2