IMPA1 Recombinant Protein Antigen

Images

 
There are currently no images for IMPA1 Protein (NBP1-83107PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IMPA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IMPA1.

Source: E.coli

Amino Acid Sequence: CIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IMPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83107.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IMPA1 Recombinant Protein Antigen

  • EC 3.1.3.25
  • IMP 1
  • IMP
  • IMP1
  • IMPA
  • IMPA1
  • IMPase 1
  • inositol monophosphatase 1
  • inositol(myo)-1(or 4)-monophosphatase 1
  • Inositol-1(or 4)-monophosphatase 1
  • Lithium-sensitive myo-inositol monophosphatase A1
  • MRT59
  • Myo-Inositol Monophosphatase 1

Background

The IMPA1 gene encodes an enyzme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-86847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-32276
Species: Hu
Applications: IP, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82541
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for IMPA1 Protein (NBP1-83107PEP) (0)

There are no publications for IMPA1 Protein (NBP1-83107PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMPA1 Protein (NBP1-83107PEP) (0)

There are no reviews for IMPA1 Protein (NBP1-83107PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IMPA1 Protein (NBP1-83107PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IMPA1 Products

Bioinformatics Tool for IMPA1 Protein (NBP1-83107PEP)

Discover related pathways, diseases and genes to IMPA1 Protein (NBP1-83107PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPA1 Protein (NBP1-83107PEP)

Discover more about diseases related to IMPA1 Protein (NBP1-83107PEP).
 

Pathways for IMPA1 Protein (NBP1-83107PEP)

View related products by pathway.

PTMs for IMPA1 Protein (NBP1-83107PEP)

Learn more about PTMs related to IMPA1 Protein (NBP1-83107PEP).
 

Research Areas for IMPA1 Protein (NBP1-83107PEP)

Find related products by research area.

Blogs on IMPA1

There are no specific blogs for IMPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IMPA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPA1