ILT6/CD85e/LILRA3 Antibody

Images

 
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL ...read more
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ILT6/CD85e/LILRA3 Antibody Summary

Immunogen
The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LILRA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-98549 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ILT6/CD85e/LILRA3 Antibody

  • CD85 antigen-like family member E
  • CD85e antigen
  • CD85e
  • HM31
  • HM43
  • ILT6
  • ILT-6
  • ILT6CD85e
  • Immunoglobulin-like transcript 6
  • leucocyte immunoglobulin-like receptor
  • Leukocyte immunoglobulin-like receptor 4
  • leukocyte immunoglobulin-like receptor A3
  • leukocyte immunoglobulin-like receptor subfamily A member 3
  • leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member3
  • LILRA3
  • LIR4
  • LIR4CD85E
  • LIR-4HM43e3
  • Monocyte inhibitory receptor HM43/HM31

Background

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-32737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-98549
Species: Hu
Applications: WB

Publications for ILT6/CD85e/LILRA3 Antibody (NBP1-98549) (0)

There are no publications for ILT6/CD85e/LILRA3 Antibody (NBP1-98549).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ILT6/CD85e/LILRA3 Antibody (NBP1-98549) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-98549:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ILT6/CD85e/LILRA3 NBP1-98549
Enlarge
4
reviewed by:
Verified Customer
WB Human 11/22/2020
View

Summary

ApplicationWestern Blot
Sample TestedHuman kidney,Human smooth muscle cells, Sample Amount: 30ug
SpeciesHuman
LotQC35754

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILT6/CD85e/LILRA3 Antibody (NBP1-98549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ILT6/CD85e/LILRA3 Products

Bioinformatics Tool for ILT6/CD85e/LILRA3 Antibody (NBP1-98549)

Discover related pathways, diseases and genes to ILT6/CD85e/LILRA3 Antibody (NBP1-98549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILT6/CD85e/LILRA3 Antibody (NBP1-98549)

Discover more about diseases related to ILT6/CD85e/LILRA3 Antibody (NBP1-98549).
 

Pathways for ILT6/CD85e/LILRA3 Antibody (NBP1-98549)

View related products by pathway.

Blogs on ILT6/CD85e/LILRA3

There are no specific blogs for ILT6/CD85e/LILRA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
11/22/2020
Application: WB
Species: Human

Bioinformatics

Gene Symbol LILRA3
Uniprot