ILT6/CD85e/LILRA3 Antibody

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL lysate. Quantity: 25 ug/lane.

Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ILT6/CD85e/LILRA3 Antibody Summary

• Immunogen: The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ILT6/CD85e/LILRA3 Antibody

• CD85 antigen-like family member E
• CD85e antigen
• CD85e
• HM31
• HM43
• ILT6
• ILT-6
• ILT6CD85e
• Immunoglobulin-like transcript 6
• leucocyte immunoglobulin-like receptor
• Leukocyte immunoglobulin-like receptor 4
• leukocyte immunoglobulin-like receptor A3
• leukocyte immunoglobulin-like receptor subfamily A member 3
• leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member3
• LILRA3
• LIR4
• LIR4CD85E
• LIR-4HM43e3
• Monocyte inhibitory receptor HM43/HM31

Background

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for ILT6/CD85e/LILRA3 Antibody (NBP1-98549) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Sam Hopkins WB Human 11/22/2020

Summary

• Application: Western Blot
• Sample Tested: Human kidney,Human smooth muscle cells, Sample Amount: 30ug
• Species: Human
• Lot: QC35754

Bioinformatics

• Gene Symbol: LILRA3
• Uniprot:
  • NP_006856()