IL-4 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related IL-4 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-68947PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-4.

Source: E. coli

Amino Acid Sequence: CDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68947.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-4 Recombinant Protein Antigen

  • B cell growth factor 1
  • BCDF
  • B-cell stimulatory factor 1
  • BCGF1
  • BCGF-1
  • binetrakin
  • BSF1
  • BSF-1
  • IL4
  • IL-4
  • IL-4B_cell stimulatory factor 1
  • IL4E12
  • interleukin 4
  • interleukin-4
  • Lymphocyte stimulatory factor 1
  • MGC79402
  • pitrakinra

Background

IL-4 (Interleukin 4, B cell stimulatory factor) is a pleiotropic cytokine produced by activated T cells, mast cells and basophils. IL-4 has many different functions including promoting proliferation and differentiation of immunologically competent cells. One of its main functions is regulating differentiation of naive CD4+ T cells into helper Th2 cells, the other main function is regulating B cells IgE and IgG1 production. Human IL-4 shows 50% homology with mouse IL-4, but its activities are species-specific and human IL-4 shows no activity on murine and rat cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
DY413
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
203-IL
Species: Hu
Applications: BA
201-LB
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut

Publications for IL-4 Recombinant Protein Antigen (NBP2-68947PEP) (0)

There are no publications for IL-4 Recombinant Protein Antigen (NBP2-68947PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-4 Recombinant Protein Antigen (NBP2-68947PEP) (0)

There are no reviews for IL-4 Recombinant Protein Antigen (NBP2-68947PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-4 Recombinant Protein Antigen (NBP2-68947PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-4 Products

Research Areas for IL-4 Recombinant Protein Antigen (NBP2-68947PEP)

Find related products by research area.

Blogs on IL-4.

Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL4