We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

IL-37/IL-1F7 Recombinant Protein Antigen

Images

 
There are currently no images for IL-37/IL-1F7 Protein (NBP2-34208PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-37/IL-1F7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL37.

Source: E. coli

Amino Acid Sequence: ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL37
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34208.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-37/IL-1F7 Recombinant Protein Antigen

  • FIL1 zeta
  • FIL1
  • FIL1(ZETA)
  • FIL1ZFIL1 zeta
  • IL-1F7
  • IL-1F7IL-1 zeta
  • IL1H4IL1F7 (canonical product IL-1F7b)
  • IL-1H4IL-1F7b (IL-1H4, IL-1H, IL-1RP1)
  • IL-1RP1IL-1X protein
  • IL1RP1interleukin 1 family member 7
  • IL-1X
  • IL37
  • IL-37
  • interleukin 1 family, member 7 (zeta)
  • interleukin 1, zeta
  • interleukin-1 family member 7
  • Interleukin-1 homolog 4
  • interleukin-1 superfamily z
  • Interleukin-1 zeta
  • Interleukin-1-related protein

Background

IL1F7 is encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1290-IL
Species: Hu
Applications: BA
DY421
Species: Mu
Applications: ELISA
782-IL
Species: Hu
Applications: BA
MAB2274
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
DY417
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
409-ML
Species: Mu
Applications: BA
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
NBP2-82145
Species: Hu
Applications: ELISA
NBP2-34208PEP
Species: Hu
Applications: AC

Publications for IL-37/IL-1F7 Protein (NBP2-34208PEP) (0)

There are no publications for IL-37/IL-1F7 Protein (NBP2-34208PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-37/IL-1F7 Protein (NBP2-34208PEP) (0)

There are no reviews for IL-37/IL-1F7 Protein (NBP2-34208PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-37/IL-1F7 Protein (NBP2-34208PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-37/IL-1F7 Products

Research Areas for IL-37/IL-1F7 Protein (NBP2-34208PEP)

Find related products by research area.

Blogs on IL-37/IL-1F7

There are no specific blogs for IL-37/IL-1F7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-37/IL-1F7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL37