IL-2 R beta Recombinant Protein Antigen

Images

 
There are currently no images for IL-2 R beta Protein (NBP2-34148PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-2 R beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL2RB.

Source: E. coli

Amino Acid Sequence: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL2RB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34148.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-2 R beta Recombinant Protein Antigen

  • CD122 antigen
  • CD122
  • high affinity IL-2 receptor beta subunit
  • High affinity IL-2 receptor subunit beta
  • IL-15 R beta
  • IL-2 R beta
  • IL-2 receptor subunit beta
  • IL2R beta
  • IL-2R subunit beta
  • IL2RB
  • IL-2Rb
  • interleukin 15 receptor, beta
  • interleukin 2 receptor, beta
  • interleukin-2 receptor subunit beta
  • P70-75
  • p75

Background

The Interleukin 2 Receptor alpha and beta chains, together with the common gamma chain, constitute the high affinity IL2 receptor present on activated T and B cells, thymocyte subset, pre B cells and T regulatory cells. Homodimeric alpha chains result in low affinity receptor, while homodimeric beta chains produce a medium affinity receptor. Normally an integral membrane protein, soluble IL2 Receptor alpha has been isolated and determined to result from extracellular proteolysis. Alternately spliced IL2 Receptor alpha mRNAs have been isolated, but the significance of each is presently unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1157
Species: Mu
Applications: IHC, WB
DBD00
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
DR2A00
Species: Hu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP2-47801
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
256-GF
Species: Hu
Applications: BA
267-N3
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NLS938
Species: Hu
Applications: IHC,  IHC-P
NBP2-34148PEP
Species: Hu
Applications: AC

Publications for IL-2 R beta Protein (NBP2-34148PEP) (0)

There are no publications for IL-2 R beta Protein (NBP2-34148PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-2 R beta Protein (NBP2-34148PEP) (0)

There are no reviews for IL-2 R beta Protein (NBP2-34148PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-2 R beta Protein (NBP2-34148PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-2 R beta Products

Research Areas for IL-2 R beta Protein (NBP2-34148PEP)

Find related products by research area.

Blogs on IL-2 R beta

There are no specific blogs for IL-2 R beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-2 R beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL2RB