IKK gamma Antibody

Images

 
Western Blot: IKK gamma Antibody [NBP1-84681] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: IKK gamma Antibody [NBP1-84681] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: IKK gamma Antibody [NBP1-84681] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Western Blot: IKK gamma Antibody [NBP1-84681] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKK gamma Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IKBKG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Antagonist
Control Peptide
IKK gamma Protein (NBP1-84681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IKK gamma Antibody

  • FIP-3IP2
  • FIP3NF-kappa-B essential modifier
  • FIP3P
  • I-kappa-B kinase subunit gamma
  • IkB kinase gamma subunit
  • IkB kinase subunit gamma
  • IkB kinase-associated protein 1
  • IKBKG
  • IKK gamma
  • IKKAP1
  • IKKG
  • IKK-gammaIPD2
  • incontinentia pigmenti
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
  • Inhibitor of nuclear factor kappa-B kinase subunit gamma
  • IP
  • IP1
  • NEMO
  • NEMOAMCBX1
  • NFkappaB essential modulator
  • NF-kappa-B essential modulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-26506
Species: Hu, Mu, Rt
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56363
Species: Hu, Mu
Applications: WB
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IKK gamma Antibody (NBP1-84681) (0)

There are no publications for IKK gamma Antibody (NBP1-84681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK gamma Antibody (NBP1-84681) (0)

There are no reviews for IKK gamma Antibody (NBP1-84681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKK gamma Antibody (NBP1-84681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKK gamma Products

Bioinformatics Tool for IKK gamma Antibody (NBP1-84681)

Discover related pathways, diseases and genes to IKK gamma Antibody (NBP1-84681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKK gamma Antibody (NBP1-84681)

Discover more about diseases related to IKK gamma Antibody (NBP1-84681).
 

Pathways for IKK gamma Antibody (NBP1-84681)

View related products by pathway.

PTMs for IKK gamma Antibody (NBP1-84681)

Learn more about PTMs related to IKK gamma Antibody (NBP1-84681).
 

Research Areas for IKK gamma Antibody (NBP1-84681)

Find related products by research area.

Blogs on IKK gamma.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKK gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IKBKG
Entrez