IKK epsilon/IKBKE Antibody

Images

 
Immunohistochemistry-Paraffin: IKBKE Antibody [NBP1-83114] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKK epsilon/IKBKE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IKBKE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IKK epsilon/IKBKE Protein (NBP1-83114PEP)
Publications
Read Publication using
NBP1-83114 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23794264).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IKK epsilon/IKBKE Antibody

  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase epsilon
  • IKBKE
  • IKK epsilon
  • IKK-E
  • IKKEMGC125297
  • IKK-epsilon
  • IKKI
  • IKK-I
  • IKK-iMGC125295
  • Inducible I kappa-B kinase
  • inducible IkappaB kinase
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
  • inhibitor of nuclear factor kappa-B kinase subunit epsilon
  • KIAA0151IKK-related kinase epsilon
  • MGC125294

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6027
Species: Hu
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for IKK epsilon/IKBKE Antibody (NBP1-83114)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IKK epsilon/IKBKE Antibody (NBP1-83114) (0)

There are no reviews for IKK epsilon/IKBKE Antibody (NBP1-83114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IKK epsilon/IKBKE Antibody (NBP1-83114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKK epsilon/IKBKE Products

Bioinformatics Tool for IKK epsilon/IKBKE Antibody (NBP1-83114)

Discover related pathways, diseases and genes to IKK epsilon/IKBKE Antibody (NBP1-83114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKK epsilon/IKBKE Antibody (NBP1-83114)

Discover more about diseases related to IKK epsilon/IKBKE Antibody (NBP1-83114).
 

Pathways for IKK epsilon/IKBKE Antibody (NBP1-83114)

View related products by pathway.

PTMs for IKK epsilon/IKBKE Antibody (NBP1-83114)

Learn more about PTMs related to IKK epsilon/IKBKE Antibody (NBP1-83114).
 

Research Areas for IKK epsilon/IKBKE Antibody (NBP1-83114)

Find related products by research area.

Blogs on IKK epsilon/IKBKE

There are no specific blogs for IKK epsilon/IKBKE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKK epsilon/IKBKE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IKBKE
Entrez