IKIP Antibody


Independent Antibodies: Western Blot: IKIP Antibody [NBP2-58695] - Analysis using Anti-IKBIP antibody NBP2-58695 (A) shows similar pattern to independent antibody NBP1-92022 (B).
Immunocytochemistry/ Immunofluorescence: IKIP Antibody [NBP2-58695] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining of human liver.
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining in human placenta and skeletal muscle tissues using anti-IKBIP antibody. Corresponding IKBIP RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining of human colon, liver, placenta and skeletal muscle using Anti-IKBIP antibody NBP2-58695 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-58695] - Staining of human colon.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

IKIP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSTLRNIRTVKRQEEEDLLRVEEQLGSDTKAIEKLEEEQHALFARDEDLTNKLSDYEPKVEECKTHLPTIESAI
Specificity of human IKIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Control Peptide
IKIP Recombinant Protein Antigen (NBP2-58695PEP)

Reactivity Notes

Mouse 85%, Rat 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for IKIP Antibody

  • FLJ31051
  • I kappa-B kinase-interacting protein
  • IKBKB interacting protein
  • IKBKB-interacting protein
  • IKIPI kappa B kinase interacting protein
  • IKK interacting protein
  • IKK-interacting protein
  • inhibitor of nuclear factor kappa-B kinase-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IKIP Antibody (NBP2-58695) (0)

There are no publications for IKIP Antibody (NBP2-58695).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKIP Antibody (NBP2-58695) (0)

There are no reviews for IKIP Antibody (NBP2-58695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKIP Antibody (NBP2-58695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IKIP Products

Bioinformatics Tool for IKIP Antibody (NBP2-58695)

Discover related pathways, diseases and genes to IKIP Antibody (NBP2-58695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on IKIP

There are no specific blogs for IKIP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IKIP Antibody and receive a gift card or discount.


Gene Symbol IKBIP