![Immunocytochemistry/Immunofluorescence: ZNF268 Antibody [NBP2-13562] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ZNF268-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13562-img0004.jpg "Immunocytochemistry/Immunofluorescence: ZNF268 Antibody [NBP2-13562] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: AQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFECTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHEQTVIGIKYCESIESGKTVNKKSQL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF268 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-13562 | Applications | Species |
|---|---|---|
| Wu, W;Yao, S;Huang, J;Qing, J;Shi, Q;Huang, J;Qiu, X;Zhuang, Y; The Expression of ZNF268 and Its Role in The Cisplatin-based Chemoresistance of Breast Cancer Heliyon 2023-08-01 [PMID: 37664731] (Immunohistochemistry) | Immunohistochemistry |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF268 |
![Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human pancreas shows no positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/ZNF268-Antibody-Immunohistochemistry-Paraffin-NBP2-13562-img0008.jpg "Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human pancreas shows no positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ZNF268-Antibody-Immunohistochemistry-Paraffin-NBP2-13562-img0005.jpg "Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human prostate shows strong cytoplasmic positivity in basal layer of glandular cells.](http://images.novusbio.com/fullsize/ZNF268-Antibody-Immunohistochemistry-Paraffin-NBP2-13562-img0006.jpg "Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human prostate shows strong cytoplasmic positivity in basal layer of glandular cells.")
![Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human skin shows strong cytoplasmic positivity in basal epidermal cells.](http://images.novusbio.com/fullsize/ZNF268-Antibody-Immunohistochemistry-Paraffin-NBP2-13562-img0007.jpg "Immunohistochemistry-Paraffin: ZNF268 Antibody [NBP2-13562] - Staining of human skin shows strong cytoplasmic positivity in basal epidermal cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ATF2 [p Thr69] Antibody - BSA Free](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0004.jpg)
![Immunohistochemistry-Paraffin ATF2 [p Thr69] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81798_rabbit-polyclonal-atf2-p-thr69-antibody-10320252332104.jpg)
![Western Blot ATF2 [p Thr69] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81798_rabbit-polyclonal-atf2-p-thr69-antibody-10320252347260.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Flow Cytometry CD160 Antibody (688327) [Unconjugated]](https://images.novusbio.com/images2/CD160_MAB6700_Flow_Cytometry_11045.jpg)
![Functional CD160 Antibody (688327) [Unconjugated]](https://images.novusbio.com/images/mab6700_human-cd160-mab-clone-688327-41202412514864.jpg)
![Functional CD160 Antibody (688327) [Unconjugated]](https://images.novusbio.com/images/mab6700_human-cd160-mab-clone-688327-4120241252136.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")