ZNF268 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF268 Antibody [NBP2-13562] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry: ZNF268 Antibody [NBP2-13562] - Staining of human uterus, post-menopause shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF268 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFECTTFGKLCLLSTK YLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHEQTV IGIKYCESIESGKTVNKKSQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF268
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF268 Protein (NBP2-13562PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF268 Antibody

  • zinc finger protein 446
  • Zinc finger protein with KRAB and SCAN domains 20
  • ZKSCAN20FLJ20626
  • ZSCAN30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-368
Species: Hu
Applications: WB
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92022
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6700
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13562
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF268 Antibody (NBP2-13562) (0)

There are no publications for ZNF268 Antibody (NBP2-13562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF268 Antibody (NBP2-13562) (0)

There are no reviews for ZNF268 Antibody (NBP2-13562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF268 Antibody (NBP2-13562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF268 Products

Bioinformatics Tool for ZNF268 Antibody (NBP2-13562)

Discover related pathways, diseases and genes to ZNF268 Antibody (NBP2-13562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF268 Antibody (NBP2-13562)

Discover more about diseases related to ZNF268 Antibody (NBP2-13562).
 

Pathways for ZNF268 Antibody (NBP2-13562)

View related products by pathway.

Blogs on ZNF268

There are no specific blogs for ZNF268, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF268 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF268