IKIP Antibody

Images

 
Independent Antibodies: Western Blot: IKIP Antibody [NBP2-56525] - Analysis using Anti-IKBIP antibody NBP2-56525 (A) shows similar pattern to independent antibody NBP2-58695 (B).
Immunocytochemistry/ Immunofluorescence: IKIP Antibody [NBP2-56525] - Staining of human cell line BJ shows localization to endoplasmic reticulum.
Orthogonal Strategies: Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining in human placenta and skeletal muscle tissues using anti-IKBIP antibody. Corresponding IKBIP RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKIP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQYDNSILKMQNELDILKEKVHDFIAYSSTGE
Specificity
Specificity of human IKIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IKBIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IKIP Recombinant Protein Antigen (NBP2-56525PEP)

Reactivity Notes

Mouse 86%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IKIP Antibody

  • FLJ31051
  • I kappa-B kinase-interacting protein
  • IKBKB interacting protein
  • IKBKB-interacting protein
  • IKIPI kappa B kinase interacting protein
  • IKK interacting protein
  • IKK-interacting protein
  • inhibitor of nuclear factor kappa-B kinase-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56074
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-77829
Species: Hu
Applications: WB, ELISA
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-13562
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85502
Species: Hu
Applications: WB, IHC, IHC-P
H00009448-M07
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-56525
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IKIP Antibody (NBP2-56525) (0)

There are no publications for IKIP Antibody (NBP2-56525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKIP Antibody (NBP2-56525) (0)

There are no reviews for IKIP Antibody (NBP2-56525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKIP Antibody (NBP2-56525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IKIP Products

Bioinformatics Tool for IKIP Antibody (NBP2-56525)

Discover related pathways, diseases and genes to IKIP Antibody (NBP2-56525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on IKIP

There are no specific blogs for IKIP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IKBIP