![Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining in human placenta and skeletal muscle tissues using anti-IKBIP antibody. Corresponding IKBIP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IKIP-Antibody-Immunohistochemistry-Paraffin-NBP2-56525-img0005.jpg "Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining in human placenta and skeletal muscle tissues using anti-IKBIP antibody. Corresponding IKBIP RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQYDNSILKMQNELDILKEKVHDFIAYSSTGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IKBIP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Retrieval method for IHC: HIER pH6 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IKBIP |
![Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/IKIP-Antibody-Immunohistochemistry-Paraffin-NBP2-56525-img0003.jpg "Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/IKIP-Antibody-Immunohistochemistry-Paraffin-NBP2-56525-img0004.jpg "Immunohistochemistry-Paraffin: IKIP Antibody [NBP2-56525] - Staining of human skeletal muscle shows low expression as expected.")
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_10080.jpg)
![Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Western_Blot_6071.jpg)
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_9872.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Agonist Activity CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/CD28_MAB342_Functional_Assay_2393.jpg)
![Immunocytochemistry CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/mab342_human-cd28-mab-clone-37407-immunocytochemistry-31102022134634.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")