IKBKAP Antibody

Images

 
Western Blot: IKBKAP Antibody [NBP2-56082] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: IKBKAP Antibody [NBP2-56082] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKBKAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD
Specificity
Specificity of human IKBKAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IKBKAP Recombinant Protein Antigen (NBP2-56082PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IKBKAP Antibody

  • DYS
  • elongator complex protein 1
  • ELP1DKFZp781H1425
  • FD
  • FLJ12497
  • IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII)
  • IkappaB kinase complex-associated protein
  • IKI3
  • IKK complex-associated protein
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein
  • p150
  • TOT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt, Bv, Ce, ChHa, Pm, RM
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single-Cell Western
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-97871
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56082
Species: Hu
Applications: WB, ICC/IF

Publications for IKBKAP Antibody (NBP2-56082) (0)

There are no publications for IKBKAP Antibody (NBP2-56082).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKBKAP Antibody (NBP2-56082) (0)

There are no reviews for IKBKAP Antibody (NBP2-56082). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKBKAP Antibody (NBP2-56082) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IKBKAP Products

Bioinformatics Tool for IKBKAP Antibody (NBP2-56082)

Discover related pathways, diseases and genes to IKBKAP Antibody (NBP2-56082). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKBKAP Antibody (NBP2-56082)

Discover more about diseases related to IKBKAP Antibody (NBP2-56082).
 

Pathways for IKBKAP Antibody (NBP2-56082)

View related products by pathway.

PTMs for IKBKAP Antibody (NBP2-56082)

Learn more about PTMs related to IKBKAP Antibody (NBP2-56082).
 

Research Areas for IKBKAP Antibody (NBP2-56082)

Find related products by research area.

Blogs on IKBKAP

There are no specific blogs for IKBKAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKBKAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP1