![Western Blot: IKBKAP Antibody [NBP2-56082] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize2/IKBKAP Antibody-Western Blot-NBP2-56082-img0002.jpg "Western Blot: IKBKAP Antibody [NBP2-56082] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD |
| Specificity | Specificity of human IKBKAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for IKBKAP Antibody (NBP2-56082)Discover more about diseases related to IKBKAP Antibody (NBP2-56082).
| Pathways for IKBKAP Antibody (NBP2-56082)View related products by pathway.
|
PTMs for IKBKAP Antibody (NBP2-56082)Learn more about PTMs related to IKBKAP Antibody (NBP2-56082).
| Research Areas for IKBKAP Antibody (NBP2-56082)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELP1 |
![Immunocytochemistry/Immunofluorescence: IKBKAP Antibody [NBP2-56082] - Staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize2/IKBKAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56082-img0001.jpg "Immunocytochemistry/Immunofluorescence: IKBKAP Antibody [NBP2-56082] - Staining of human cell line U-2 OS shows localization to cytosol.")
![Flow Cytometry: Integrin alpha L/CD11a Antibody (MEM-25) [NB500-328] - Separation of human monocytes (red-filled) from blood debris (black-dashed) in flow cytometry analysis (surface staining) of human peripheral whole blood stained using anti-human CD11a (MEM-25) purified antibody (concentration in sample 1 ug/ml) GAM APC.](http://images.novusbio.com/images2/Integrin-alpha-L-CD11a-Antibody-(MEM-25)-Flow-Cytometry-NB500-328-img0004.jpg)
![Flow Cytometry: Integrin alpha L/CD11a Antibody (MEM-25) [NB500-328] - Analysis using the PE conjugate of NB500-328. Surface staining of human peripheral blood cells with anti-human CD11a (MEM-25) PE.](http://images.novusbio.com/images2/Integrin-alpha-L-CD11a-Antibody-(MEM-25)-Flow-Cytometry-NB500-328-img0002.jpg)
![Flow Cytometry: Integrin alpha L/CD11a Antibody (MEM-25) [NB500-328] - Staining pattern of human peripheral whole blood stained using anti-human CD11a (MEM-25) purified antibody (concentration in sample 1 ug/ml) GAM APC.](http://images.novusbio.com/images2/Integrin-alpha-L-CD11a-Antibody-(MEM-25)-Flow-Cytometry-NB500-328-img0003.jpg)
![Immunohistochemistry: CD11b Antibody [NB110-89474] - Staining of mouse pancreas using [NB110-89474] at 1:400 dilution. Nuclei counterstained with 4',6-diamidino-2-phenylindole (DAPI) (blue). Image from product review by verified customer.](http://images.novusbio.com/images2/CD11b-Antibody-Immunocytochemistry-Immunofluorescence-NB110-89474-img0010.jpg)
![Dual RNAscope ISH-IHC: CD11b Antibody [NB110-89474] - Formalin-fixed paraffin-embedded tissue sections of human lymph node were probed for CD11b mRNA (ACD RNAScope Probe, catalog #555098; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Rabbit Polyclonal (Novus Biologicals catalog #NB110-89474) at 1:50 dilution with 1 hour incubation at room temperature followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.](http://images.novusbio.com/images2/CD11b-Antibody-Dual-RNAscope-ISH-IHC-NB110-89474-img0025.jpg)
![Immunohistochemistry: CD11b Antibody [NB110-89474] - Glibenclamide and Abcc8-/- suppress immune cell infiltration in EAE. White matter of lumbar spinal cord sections from WT control (a), untreated pid-30 WT/EAE (b), glibenclamide-treated pid-30 WT/EAE (c), and pid-30 Abcc8-/-/EAE (d) mice, stained with H&E or immunolabeled for CD45 (leucocyte), CD3 (T cells), CD20 (B cells), or CD11b (macrophage/microglia), as indicated; original magnification, x200 (H&E) or x400 (all immunolabelings). eleft panel: percent of quadrants with inflammatory cells on H&E; four mice/group. efour right panels: Quantification of CD-45-, CD3-, CD20-, and CD11b-expressing cells in white matter; four mice/group; ##P < 0.01 with respect to WT control; **P < 0.01, and ***P < 0.001 with respect to WT/EAE; scale bars, 100 um Image collected and cropped by CiteAb from the following publication (http://www.jneuroinflammation.com/content/12/1/210) licensed under a CC-BY licence.](http://images.novusbio.com/images2/CD11b-Antibody-Immunohistochemistry-NB110-89474-img0024.jpg)
![Immunohistochemistry-Paraffin: CD11c Antibody (AP-MAB0806) [NB110-97871] - Mouse spleen tissue.](http://images.novusbio.com/images2/CD11c-Antibody-(AP-MAB0806)-Immunohistochemistry-Paraffin-NB110-97871-img0002.jpg)
![Immunohistochemistry-Paraffin: CD11c Antibody (AP-MAB0806) [NB110-97871] - Negative control, mouse spleen tissue section.](http://images.novusbio.com/images2/CD11c-Antibody-(AP-MAB0806)-Immunohistochemistry-NB110-97871-img0003.jpg)
![Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/SLC17A5 Antibody-Western Blot-NBP2-20383-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.](http://images.novusbio.com/images2/SLC17A5 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-20383-img0003.jpg)
![Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min](http://images.novusbio.com/images2/Sialin-SLC17A5-Antibody-Immunohistochemistry-Paraffin-NBP2-20383-img0004.jpg)
![Western Blot: RanGAP1 Antibody (1B4) [NBP2-02623] Analysis of extracts (35ug) from 9 different cell lines by using anti-RanGAP1 monoclonal antibody.](http://images.novusbio.com/images/RanGAP1 Antibody (1B4)-Western Blot-NBP2-02623-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY RanGAP1.](http://images.novusbio.com/images/RanGAP1 Antibody (1B4)-Immunocytochemistry-Immunofluorescence-NBP2-02623-img0008.jpg)
![Immunohistochemistry-Paraffin: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of paraffin-embedded Human prostate tissue using anti-RanGAP1 mouse monoclonal antibody.](http://images.novusbio.com/images/RanGAP1 Antibody (1B4)-Immunohistochemistry-Paraffin-NBP2-02623-img0007.jpg)
![Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).](http://images.novusbio.com/images2/HLA DQ Antibody (SPV-L3)-Flow Cytometry-NBP2-45041-img0001.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0018.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0013.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0010.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0007.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0008.jpg)
![Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Western-Blot-NBP2-13883-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13883-img0006.jpg)
![Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Immunohistochemistry-Paraffin-NBP2-13883-img0011.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")