IKBKAP Antibody - BSA Free

Western Blot: IKBKAP Antibody [NBP2-56082] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: IKBKAP Antibody [NBP2-56082] - Staining of human cell line U-2 OS shows localization to cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IKBKAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IKBKAP Recombinant Protein Antigen (NBP2-56082PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IKBKAP Antibody - BSA Free

• DYS
• elongator complex protein 1
• ELP1DKFZp781H1425
• FD
• FLJ12497
• IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII)
• IkappaB kinase complex-associated protein
• IKI3
• IKK complex-associated protein
• inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein
• p150
• TOT1

Background

The protein encoded by the IKBKAP gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELP1