Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NFKBIA |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IkB-alpha Antibody (NBP1-87761)Find related products by research area.
|
Sample collection from mammalian culture cells for kinomic analysis By Jamshed Arslan Pharm.D., PhD.IntroductionKinome describes kinases, and kinomics refers to the kinase signaling. Studying the effects of reagent (exogenously applied growth factor or inhibitor) on kinase activit... Read full blog post. |
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
Inhibitor kappa B-alpha (IkappaB-alpha) The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.