IGSF6/DORA Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGSF6. Source: E. coli
Amino Acid Sequence: VTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IGSF6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84061. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IGSF6/DORA Recombinant Protein Antigen
Background
DORA stands for down-regulated by activation.The Immunoglobulin Superfamily (IgSF) is a group of proteins that are involved in the recognition, binding, or adhesion processes of cells. IgSF proteins got their name because they possess an immunoglobulin (Ig) domain. DORA is also known as protein Immunoglobulin superfamily member 6. Immunoglobulin Superfamily Member 6, IGSF6, has been localized to a locus linked with inflammatory bowel disease; however, studies have shown that it lacks an association to the condition.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP) (0)
There are no publications for IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP) (0)
There are no reviews for IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP) (0)
Additional IGSF6/DORA Products
Blogs on IGSF6/DORA