IGSF1 Antibody (4C7) - Azide and BSA Free

Western Blot: IGSF1 Antibody (4C7) [H00003547-M01] - IGSF1 monoclonal antibody (M01), clone 4C7. Analysis of IGSF1 expression in rat brain.

Western Blot: IGSF1 Antibody (4C7) [H00003547-M01] - IGSF1 monoclonal antibody (M01), clone 4C7. Analysis of IGSF1 expression in HeLa.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 4C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

IGSF1 Antibody (4C7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: IGSF1 (NP_001546, 220 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD
• Specificity: IGSF1 - immunoglobulin superfamily, member 1 (4C7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IGSF1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGSF1 Antibody (4C7) - Azide and BSA Free

• CHTE
• IGCD1
• IGDC1
• IGDC1Pituitary gland-specific factor 2
• IGSF1
• immunoglobulin superfamily member 1
• immunoglobulin superfamily, member 1
• Immunoglobulin-like domain-containing protein 1
• InhBP
• Inhibin-binding protein
• KIAA0364p120
• MGC75490
• p120
• PGSF2
• PGSF2IGCD1

Background

Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGSF1
• Entrez:
  • 3547(Human)
• Uniprot:
  • NP_001546()