IGFBP-rp1/IGFBP-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: IGFBP-rp1/IGFBP-7 Antibody [NBP1-83415] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IGFBP-rp1/IGFBP-7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGFBP7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23713052)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IGFBP-rp1/IGFBP-7 Antibody - BSA Free

• angiomodulin
• FSTL2
• IBP-7
• IGFBP7
• IGFBP-7
• IGFBP-7PGI2-stimulating factor
• IGFBP-7v
• IGFBPrp1
• IGFBP-rp1
• insulin-like growth factor binding protein 7
• insulin-like growth factor-binding protein 7
• MAC25 protein
• Mac25
• MAC25IGF-binding protein 7
• Prostacyclin-stimulating factor
• PSF
• PSFAGM
• TAF
• Tumor-derived adhesion factor

Background

Observational study of gene-disease association. (HuGE Navigator. A genome-wide RNA-interference screening to identify genes required for an activated BRAF oncogene to block proliferation of fibroblasts and melanocytes revealed that a IGFBP7, has a central role in BRAF-mediated senescence and apoptosis. This study supports the role of IGFBP-1, -3 and -7 as potential tumour suppressor genes in human breast cancer. IGFBP7 plays a potential tumor suppressor role in colorectal carcinogenesis. Expression in tumor cells may reduce the anchorage-independent growth ability, leading to the marked loss of tumorigenicity. discovered the implication of insulin-like growth factor-binding protein-related protein 1 in endometrial physiology, which seems related to endometrial receptivity. data suggest that mac25/IGFBP-rP1 and 25.1 may play a functional role in the NE differentiation of NSCLC cell lines and may provide a novel therapeutic target for treating lung cancers, in particular NSCLC with NE differentiation. findings show for the first time that circulating IGF-binding protein (IGFBP)-related protein 1 (IGFBP-rP1) is increased with insulin resistance. that IGFBP-rP1 is an inhibitor of MCF-7 breast cancer cell proliferation and may act via a cellular senescence-like mechanism. IGFBP7 plays a potential tumor suppressor role against colorectal carcinogenesis and its expression is associated with DNA hypomethylation of exon 1. mRNA expression was lost in six out of eight CRC cell lines as compared to normal colon cells. DNA methylation was found in the region of exon 1 and intron 1 of IGFBP-7. tumor-suppressive activity is through induction of apoptosis in an IGF-I independent manner in prostate cancer. SOX9 contributes to growth regulation by mac25 via inhibition of cell growth and promotion of differentiation. In prostate cancer cells, one of the downstream mediators of the senescence-associated tumor suppression effect of mac25/IGFBP-rP1 is superoxide dismutase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)(3)

Publications using NBP1-83415

• Gambaro K, Quinn MC, Caceres-Gorriti KY et al. Low levels of IGFBP7 expression in high-grade serous ovarian carcinoma is associated with patient outcome. BMC Cancer 2015-03-17 [PMID: 25886299] (IF/IHC, Human)
• Alexandre Calon, Enza Lonardo, Antonio Berenguer-Llergo et al. Stromal gene expression defines poor-prognosis subtypes in colorectal cancer. Nature Genetics 2015-02-23 [PMID: 25706628] (IF/IHC, Human)
• Chugh S, Ouzounian M, Lu Z et al. Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure. Proteomics 2013-08-01 [PMID: 23713052]

Bioinformatics

• Gene Symbol: IGFBP7