IGFBP-rp1/IGFBP-7 Antibody

Images

 
Immunohistochemistry-Paraffin: IGFBP-rp1/IGFBP-7 Antibody [NBP1-83415] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFBP-rp1/IGFBP-7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFBP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP)
Publications
Read Publications using
NBP1-83415 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23713052)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFBP-rp1/IGFBP-7 Antibody

  • angiomodulin
  • FSTL2
  • IBP-7
  • IGFBP7
  • IGFBP-7
  • IGFBP-7PGI2-stimulating factor
  • IGFBP-7v
  • IGFBPrp1
  • IGFBP-rp1
  • insulin-like growth factor binding protein 7
  • insulin-like growth factor-binding protein 7
  • MAC25 protein
  • Mac25
  • MAC25IGF-binding protein 7
  • Prostacyclin-stimulating factor
  • PSF
  • PSFAGM
  • TAF
  • Tumor-derived adhesion factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)(3)

Reviews for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415) (0)

There are no reviews for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFBP-rp1/IGFBP-7 Products

Bioinformatics Tool for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)

Discover related pathways, diseases and genes to IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)

Discover more about diseases related to IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415).
 

Pathways for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)

View related products by pathway.

PTMs for IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415)

Learn more about PTMs related to IGFBP-rp1/IGFBP-7 Antibody (NBP1-83415).

Blogs on IGFBP-rp1/IGFBP-7

There are no specific blogs for IGFBP-rp1/IGFBP-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFBP-rp1/IGFBP-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFBP7
Entrez