IGFBP-6 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IGFBP6 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for IGFBP-6 Antibody - BSA Free
Background
Data show that an increase in JNK activation in the presence of NFkappaB inhibition significantly increased the expression of IGFBP6. These studies provide evidence that over expression of IGFBP-6 suppresses human and murine osteoblast differentiation, that IGFBP-6 and LMP-1 physically interact, and supports the conclusion that this interaction may be functionally relevant. IGFBP-6 is the effector of tumor suppressor activity of SEMA3B. Observational study of gene-disease association. (HuGE Navigator) IGFBP-6 is translocated to the nucleus with functional consequences, and different members of the IGFBP family have specific nuclear import mechanisms. Toxic effect of TCDD on osteogenesis through altering IGFBP6 gene expression in osteoblasts is reported. p38 MAPK is involved in IGFBP-6-induced IGF-independent rhabdomyosarcoma cell migration. determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation. Inhibition of human osteoblast marker gene expression by retinoids is mediated in part by insulin-like growth factor binding protein-6. A close correlation exists between residues of the carboxyl-terminal domain of IGFBP6 undergoing conformational change in 15N NMR spectroscopy studies with those that disappeared or broadened upon insulin-like growth factor (IGF-II) binding. C-domain of IGFBP-6 consists of a thyroglobulin type 1 fold comprising an alpha-helix followed by a loop, a three-stranded antiparallel beta-sheet incorporating a second loop, and a disulfide-bonded flexible third loop. The expression of certain IGFBP is significantly altered in renal cell carcinoma. CCI-779 acts additively with IGFBP-6 to reduce rhabdomyosarcoma growth both in vitro and in vivo. may function as an antiproliferative molecule suppressing mitogenic effects of insulin-like growth factors on Malassez cells. The IGFBP-6 protein is synthesized as propeptides with a hydrophobic leader sequence, removal of which yields a mature protein composed of 3 recognizable domains of similar size. transgenic human IGFBP-6 mice may be considered a new tool for studies of the involvement of the brain IGF system in metabolism control and obesity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Publications for IGFBP-6 Antibody (NBP1-86495) (0)
There are no publications for IGFBP-6 Antibody (NBP1-86495).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGFBP-6 Antibody (NBP1-86495) (0)
There are no reviews for IGFBP-6 Antibody (NBP1-86495).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IGFBP-6 Antibody (NBP1-86495) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IGFBP-6 Products
Research Areas for IGFBP-6 Antibody (NBP1-86495)
Find related products by research area.
|
Blogs on IGFBP-6