IGFBP-2 Antibody (4B2G6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP-2 (P18065). PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
IGFBP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IGFBP-2 Antibody (4B2G6)
Background
IGFBP2 is a member of the ISGBP family which bind various IGFs. IGFBP2 is over expressed in a wide spectrum of other cancers, including glioma, prostate cancer, synovial sarcoma, neuroblastoma, colon cancer, adrenocortical cancer, lung cancer, Wilms' tumor, and hepatoblastoma. The over expression of IGFBP2 also correlates with the aggressiveness of some tumors. IGFBP2 activates the expression of matrix metalloprotease 2, which contributes to cell invasiveness.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, Neut, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Mu
Applications: ELISA
Publications for IGFBP-2 Antibody (NBP3-16733) (0)
There are no publications for IGFBP-2 Antibody (NBP3-16733).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGFBP-2 Antibody (NBP3-16733) (0)
There are no reviews for IGFBP-2 Antibody (NBP3-16733).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGFBP-2 Antibody (NBP3-16733) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IGFBP-2 Products
Research Areas for IGFBP-2 Antibody (NBP3-16733)
Find related products by research area.
|
Blogs on IGFBP-2