IGF2BP1 Antibody - BSA Free

Immunoprecipitation: IGF2BP1 Antibody [NBP3-35366] - Immunoprecipitation analysis of 200 ug extracts of K562 cells using IGF2BP1 antibody. Western blot was performed from the immunoprecipitate using IGF2BP1/IMP1 antibody at a dilution of 1:1000.

Western Blot: IGF2BP1 Antibody [NBP3-35366] - Western blot analysis of various lysates using IGF2BP1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IGF2BP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IGF2BP1 Antibody - BSA Free (NBP3-35366) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 478-577 of human IGF2BP1 (NP_006537.3).
  
  Sequence:
  FGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGF2BP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IGF2BP1 Antibody - BSA Free

• Coding region determinant-binding protein
• CRD-BP
• CRDBPIGF-II mRNA-binding protein 1
• IGF II mRNA binding protein 1
• IMP1
• IMP-1ZBP-1
• insulin-like growth factor 2 mRNA binding protein 1
• insulin-like growth factor 2 mRNA-binding protein 1
• VICKZ family member 1
• VICKZ1
• ZBP1IGF2 mRNA-binding protein 1
• Zip code-binding protein 1
• Zipcode-binding protein 1

Background

The IGF2BP1 gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGF2BP1