IGF2BP1 Antibody - BSA Free

Western Blot: IGF2BP1 Antibody [NBP1-57495] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495] - Human lung adenocarcinoma

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495] - Human lung adenocarcinoma.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IGF2BP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human IGF2BP1. Peptide sequence: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGF2BP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 63.481 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IGF2BP1 Antibody - BSA Free

• Coding region determinant-binding protein
• CRD-BP
• CRDBPIGF-II mRNA-binding protein 1
• IGF II mRNA binding protein 1
• IMP1
• IMP-1ZBP-1
• insulin-like growth factor 2 mRNA binding protein 1
• insulin-like growth factor 2 mRNA-binding protein 1
• VICKZ family member 1
• VICKZ1
• ZBP1IGF2 mRNA-binding protein 1
• Zip code-binding protein 1
• Zipcode-binding protein 1

Background

IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGF2BP1 Antibody (NBP1-57495)(1)

Publication using NBP1-57495

• Hsieh YT, Chou MM, Chen HC, Tseng JJ. IMP1 promotes choriocarcinoma cell migration and invasion through the novel effectors RSK2 and PPME1. Gynecol Oncol. 2013-10-01 [PMID: 23911878]

Bioinformatics

• Gene Symbol: IGF2BP1
• Entrez:
  • 10642(Human)
• Uniprot:
  • Q9NZI8(Human)