IGF-II R/IGF2R Recombinant Protein Antigen

Images

 
There are currently no images for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IGF-II R/IGF2R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGF2R.

Source: E. coli

Amino Acid Sequence: CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGF2R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84598.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGF-II R/IGF2R Recombinant Protein Antigen

  • 300 kDa mannose 6-phosphate receptor
  • cation-independent mannose-6 phosphate receptor
  • cation-independent mannose-6-phosphate receptor
  • CD222 antigen
  • CD222
  • CI Man-6-P receptor
  • CIMPR
  • CI-MPR
  • IGF2R
  • IGF-II R
  • IGF-II receptor
  • IGFIIR
  • IGF-IIR
  • insulin-like growth factor 2 receptorM6P/IGF2R
  • Insulin-like growth factor II receptor
  • M6P/IGF2 receptor
  • M6PR
  • M6P-R
  • MPR 300
  • MPR1
  • MPRI
  • MPRIM6PR

Background

CD222 is a 250kDa transmembrane protein with a short cytoplasmic tail containing an internalization signal. CD222 was originally identified as a receptor for IGFII and M6P-containing proteins (e.g. lysosomal hydrolases). Lysosomal enzymes are sorted to lysosomes via CD222 either from the Golgi, where the enzymes acquire M6P, or from the extracellular space. The majority of CD222 molecules (approximately 90-95%) are located intracellularly, only 5-10% is present on the cell membrane. The internalization rate seems to be enhanced by ligand induced dimerization of CD222 as well as by phosphorylation of its cytoplasmic serine. CD222 is also a receptor for TGFbeta latency associated peptide (LAP), proliferin and may bind several molecules independently of M6P, including plasminogen, CD87 or retinoic acid. It is involved in activation of latent TGFbeta [PROW].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
291-G1
Species: Hu
Applications: BA
MAB391
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
DGB300
Species: Hu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
1310-SE
Species: Hu
Applications: EnzAct
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
DUP00
Species: Hu
Applications: ELISA
NBP1-83220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-84598PEP
Species: Hu
Applications: AC

Publications for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP) (0)

There are no publications for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP) (0)

There are no reviews for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGF-II R/IGF2R Products

Research Areas for IGF-II R/IGF2R Recombinant Protein Antigen (NBP1-84598PEP)

Find related products by research area.

Blogs on IGF-II R/IGF2R

There are no specific blogs for IGF-II R/IGF2R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGF-II R/IGF2R Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2R