IFN-gamma R2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IFN-gamma R2 Antibody [NBP1-90223] - Staining of human cell line SiHa shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Analysis in human stomach and liver tissues using Anti-IFNGR2 antibody. Corresponding IFNGR2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IFN-gamma R2 Antibody [NBP1-90223] - Staining of human stomach shows high expression.

Immunohistochemistry-Paraffin: IFN-gamma R2 Antibody [NBP1-90223] - Staining of human liver shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IFN-gamma R2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFNGR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IFN-gamma R2 Protein (NBP1-90223PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IFN-gamma R2 Antibody - BSA Free

• AF-1
• AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1
• IFGR2
• IFN-gamma R2
• IFN-gamma receptor 2
• IFNgammaR2
• IFN-gamma-R2
• IFNGR2
• IFN-gR2
• IFNGT1
• interferon gamma receptor 2 (interferon gamma transducer 1)
• interferon gamma receptor 2
• interferon gamma receptor accessory factor-1
• interferon gamma receptor beta chain
• Interferon gamma transducer 1

Background

IFN gamma Receptor beta encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFN-gamma R2 Antibody (NBP1-90223)(1)

Publication using NBP1-90223

• Ivanidze J, Hoffmann R, Lochmuller H et al. Inclusion body myositis: laser microdissection reveals differential up-regulation of IFN-Gamma signaling cascade in attacked versus nonattacked myofibers. Am J Pathol 2011-09-01 [PMID: 21855683]

Review for IFN-gamma R2 Antibody (NBP1-90223) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer ICC Human 12/23/2015

Summary

• Application: Immunocytochemistry
• Sample Tested: Mesenchymal stem cells
• Species: Human

FAQs for IFN-gamma R2 Antibody (NBP1-90223). (Showing 1 - 1 of 1 FAQ).

1. Do you have specific protocol for your IFNgR2 antibody (NBP1-90223) for immunocytochemistry (ICC)? More specifically, how do you recommend fixing the cells?
   • We have not validated this antibody for the ICC application and, therefore, cannot recommend a protocol. The antibody has been validated in IHC and WB. Your standard protocol for ICC can be found at this link. If you do use this antibody for ICC, you can send your results to us whether negative or positive (if they are tightly controlled) and qualify for the Innovator's reward. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Bioinformatics

• Gene Symbol: IFNGR2
• Entrez:
  • 3460(Human)
• Uniprot:
  • P38484()