IFN-gamma R2 Antibody

Images

 
Western Blot: IFN-gamma R2 Antibody [NBP1-90223] - Analysis in control (vector only transfected HEK293T lysate) and IFNGR2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: IFN-gamma R2 Antibody [NBP1-90223] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: IFN-gamma R2 Antibody [NBP1-90223] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFN-gamma R2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNGR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.The antibody works in ICC/IF per customer review.
Control Peptide
IFN-gamma R2 Protein (NBP1-90223PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90223 in the following applications:

Publications
Read Publication using NBP1-90223.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFN-gamma R2 Antibody

  • AF-1
  • AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1
  • IFGR2
  • IFN-gamma R2
  • IFN-gamma receptor 2
  • IFNgammaR2
  • IFN-gamma-R2
  • IFNGR2
  • IFN-gR2
  • IFNGT1
  • interferon gamma receptor 2 (interferon gamma transducer 1)
  • interferon gamma receptor 2
  • interferon gamma receptor accessory factor-1
  • interferon gamma receptor beta chain
  • Interferon gamma transducer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6731
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5540
Species: Mu
Applications: WB
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr

Publications for IFN-gamma R2 Antibody (NBP1-90223)(1)

Review for IFN-gamma R2 Antibody (NBP1-90223) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ICC.

Reviews using NBP1-90223:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry IFN-gamma R2 NBP1-90223
Enlarge
reviewed by:
Anonymous
ICC Human 12/23/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedMesenchymal stem cells
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsImage courtesy of product review submitted by Dr. Amir Kol of UC Davis.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IFN-gamma R2 Antibody (NBP1-90223). (Showing 1 - 1 of 1 FAQ).

  1. Do you have specific protocol for your IFNgR2 antibody (NBP1-90223) for immunocytochemistry (ICC)? More specifically, how do you recommend fixing the cells?
    • We have not validated this antibody for the ICC application and, therefore, cannot recommend a protocol. The antibody has been validated in IHC and WB. Your standard protocol for ICC can be found at this link. If you do use this antibody for ICC, you can send your results to us whether negative or positive (if they are tightly controlled) and qualify for the Innovator's reward. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional IFN-gamma R2 Products

Bioinformatics Tool for IFN-gamma R2 Antibody (NBP1-90223)

Discover related pathways, diseases and genes to IFN-gamma R2 Antibody (NBP1-90223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-gamma R2 Antibody (NBP1-90223)

Discover more about diseases related to IFN-gamma R2 Antibody (NBP1-90223).
 

Pathways for IFN-gamma R2 Antibody (NBP1-90223)

View related products by pathway.

PTMs for IFN-gamma R2 Antibody (NBP1-90223)

Learn more about PTMs related to IFN-gamma R2 Antibody (NBP1-90223).

Blogs on IFN-gamma R2

There are no specific blogs for IFN-gamma R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
12/23/2015
Application: ICC
Species: Human

Bioinformatics

Gene Symbol IFNGR2
Entrez
Uniprot