IFIT2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit IFIT2 Antibody - Azide and BSA Free (NBP3-04917) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4). ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IFIT2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for IFIT2 Antibody - Azide and BSA Free
Background
Saha et al. used this antibody to study protein expression of murine GARG39/IFIT2 in relation to viral infection. Immunofluorescence localized this protein in association with the mitotic spindle in both mitotically active normal NIH3T3 and B16F10 melanoma cells. Western blotting shows approx. 55 kD band GARG39/IFIT2 in brain tissue of mice infected with Japanese encephalitis virus (JEV). Brain tissue from non-infected mice did not display this band. In 1994 Bluyssen et al. characterized the gene for murine GARG39/IFIT2 and historically the protein has been identified as interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), interferon-induced 54 kDa protein (IFI-54K), glucocorticoid-attenuated response gene 39 protein (GARG-39). Human IFIT2, with 62% amino acid sequence identity, has been referred to as Interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), Interferon-induced 54 kDa protein (IFI-54K) and ISG-54 K. Kang et al. showed with proteome analysis IFIT2 was expressed more than two-fold in human osteosarcoma cells U2OS treated with ascochlorin. Kawada et al. studied gene expression to show that IFIT2 is strongly upregulated in peripheral blood in children during the acute phase of influenza.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for IFIT2 Antibody (NBP3-04917) (0)
There are no publications for IFIT2 Antibody (NBP3-04917).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFIT2 Antibody (NBP3-04917) (0)
There are no reviews for IFIT2 Antibody (NBP3-04917).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFIT2 Antibody (NBP3-04917) (0)