IF3EI Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IF3EI Antibody [NBP1-87955] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: IF3EI Antibody [NBP1-87955] - Staining of human stomach shows strong cytoplasmic and moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IF3EI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IF3EI Protein (NBP1-87955PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IF3EI Antibody

  • eIEF associated protein HSPC021
  • EIF3EIP
  • eIF3l
  • EIF3S11
  • EIF3S6IP
  • Eukaryotic translation initiation factor 3 subunit 6-interacting protein
  • Eukaryotic translation initiation factor 3 subunit E-interacting protein
  • eukaryotic translation initiation factor 3 subunit L
  • eukaryotic translation initiation factor 3, subunit 6 interacting protein
  • eukaryotic translation initiation factor 3, subunit L
  • HSPC021
  • HSPC025
  • MSTP005
  • subunit E interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77997
Species: Hu, Mu, Rt, Bv, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO

Publications for IF3EI Antibody (NBP1-87955) (0)

There are no publications for IF3EI Antibody (NBP1-87955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IF3EI Antibody (NBP1-87955) (0)

There are no reviews for IF3EI Antibody (NBP1-87955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IF3EI Antibody (NBP1-87955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IF3EI Products

Bioinformatics Tool for IF3EI Antibody (NBP1-87955)

Discover related pathways, diseases and genes to IF3EI Antibody (NBP1-87955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IF3EI Antibody (NBP1-87955)

Discover more about diseases related to IF3EI Antibody (NBP1-87955).
 

Pathways for IF3EI Antibody (NBP1-87955)

View related products by pathway.

PTMs for IF3EI Antibody (NBP1-87955)

Learn more about PTMs related to IF3EI Antibody (NBP1-87955).
 

Research Areas for IF3EI Antibody (NBP1-87955)

Find related products by research area.

Blogs on IF3EI

There are no specific blogs for IF3EI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IF3EI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3L