IDH3B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IDH3B Antibody [NBP3-35384] - Immunofluorescence analysis of L929 cells using IDH3B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: IDH3B Antibody [NBP3-35384] - Western blot analysis of lysates from Rat heart, using IDH3B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Western Blot: IDH3B Antibody [NBP3-35384] - Western blot analysis of various lysates using IDH3B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IDH3B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IDH3B Antibody - BSA Free (NBP3-35384) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2).
  
  Sequence:
  ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for IDH3B Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.41
• FLJ11043
• H-IDHB
• isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
• isocitrate dehydrogenase 3 (NAD+) beta
• isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
• Isocitric dehydrogenase subunit beta
• MGC903
• NAD(+)-specific ICDH subunit beta
• NAD+-specific ICDH
• NAD+-specific isocitrate dehydrogenase b subunit
• NAD+-specific isocitrate dehydrogenase beta
• RP46

Background

IDH3B codes for a protein that has three isoforms, with lengths of 385, 383, and 233 amino acids, and weights of 42, 42, and 26 kDa respectively, and is a protein that is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase, which localizes to the mitochondrial matrix. Current studies are being done on several diseases and disorders related to this gene, including retinitis pigmentosa, blindness, and ataxia. IDH3B has also been shown to have interactions with MAPK6, MYC, IDH3G, PHLDA3, and IDH3A in pathways such as the TCA cycle and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IDH3B