IDH3B Antibody

Images

 
Independent Antibodies: Western Blot: IDH3B Antibody [NBP2-58706] - Analysis using Anti-IDH3B antibody NBP2-58706 (A) shows similar pattern to independent antibody NBP2-14114 (B).
Immunocytochemistry/ Immunofluorescence: IDH3B Antibody [NBP2-58706] - Staining of human cell line A549 shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

IDH3B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Predicted Species
Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDH3B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IDH3B Recombinant Protein Antigen (NBP2-58706PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IDH3B Antibody

  • EC 1.1.1
  • EC 1.1.1.41
  • FLJ11043
  • H-IDHB
  • isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
  • isocitrate dehydrogenase 3 (NAD+) beta
  • isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
  • Isocitric dehydrogenase subunit beta
  • MGC903
  • NAD(+)-specific ICDH subunit beta
  • NAD+-specific ICDH
  • NAD+-specific isocitrate dehydrogenase b subunit
  • NAD+-specific isocitrate dehydrogenase beta
  • RP46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-84929
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85871
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-81967
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-49588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49242
Species: Hu
Applications: IHC, IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NBP2-02158
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2045
Species: Hu
Applications: ICC, IHC, WB
NBP1-85269
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7550
Species: Hu
Applications: KO, WB
NBP2-67698
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for IDH3B Antibody (NBP2-58706) (0)

There are no publications for IDH3B Antibody (NBP2-58706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IDH3B Antibody (NBP2-58706) (0)

There are no reviews for IDH3B Antibody (NBP2-58706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IDH3B Antibody (NBP2-58706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IDH3B Products

Bioinformatics Tool for IDH3B Antibody (NBP2-58706)

Discover related pathways, diseases and genes to IDH3B Antibody (NBP2-58706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDH3B Antibody (NBP2-58706)

Discover more about diseases related to IDH3B Antibody (NBP2-58706).
 

Pathways for IDH3B Antibody (NBP2-58706)

View related products by pathway.

PTMs for IDH3B Antibody (NBP2-58706)

Learn more about PTMs related to IDH3B Antibody (NBP2-58706).

Blogs on IDH3B

There are no specific blogs for IDH3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IDH3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH3B