IDH3B Antibody

Western Blot: IDH3B Antibody [NBP2-58706] - Analysis using Anti-IDH3B antibody NBP2-58706 (A) shows similar pattern to independent antibody NBP2-14114 (B).

Immunocytochemistry/Immunofluorescence: IDH3B Antibody [NBP2-58706] - Staining of human cell line A549 shows localization to mitochondria.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IDH3B Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
• Predicted Species: Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IDH3B Recombinant Protein Antigen (NBP2-58706PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IDH3B Antibody

• EC 1.1.1
• EC 1.1.1.41
• FLJ11043
• H-IDHB
• isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
• isocitrate dehydrogenase 3 (NAD+) beta
• isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
• Isocitric dehydrogenase subunit beta
• MGC903
• NAD(+)-specific ICDH subunit beta
• NAD+-specific ICDH
• NAD+-specific isocitrate dehydrogenase b subunit
• NAD+-specific isocitrate dehydrogenase beta
• RP46

Background

IDH3B codes for a protein that has three isoforms, with lengths of 385, 383, and 233 amino acids, and weights of 42, 42, and 26 kDa respectively, and is a protein that is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase, which localizes to the mitochondrial matrix. Current studies are being done on several diseases and disorders related to this gene, including retinitis pigmentosa, blindness, and ataxia. IDH3B has also been shown to have interactions with MAPK6, MYC, IDH3G, PHLDA3, and IDH3A in pathways such as the TCA cycle and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IDH3B