IDH3B Antibody

Images

 
Western Blot: IDH3B Antibody [H00003420-D01P] - Analysis of IDH3B expression in transfected 293T cell line by IDH3B polyclonal antibody.Lane 1: IDH3B transfected lysate(42.20 KDa).Lane 2: Non-transfected lysate.
Western Blot: IDH3B Antibody [H00003420-D01P] - WB analysis of IDH3B in HCT116 whole cell lysate. Image courtesy of anonymous customer product review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IDH3B Antibody Summary

Immunogen
IDH3B (NP_008830.2, 1 a.a. - 385 a.a.) full-length human protein. MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Specificity
IDH3B - isocitrate dehydrogenase 3 (NAD+) beta,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDH3B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 3
using
H00003420-D01P in the following application:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IDH3B Antibody

  • EC 1.1.1
  • EC 1.1.1.41
  • FLJ11043
  • H-IDHB
  • isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
  • isocitrate dehydrogenase 3 (NAD+) beta
  • isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
  • Isocitric dehydrogenase subunit beta
  • MGC903
  • NAD(+)-specific ICDH subunit beta
  • NAD+-specific ICDH
  • NAD+-specific isocitrate dehydrogenase b subunit
  • NAD+-specific isocitrate dehydrogenase beta
  • RP46

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84929
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54755
Species: Hu
Applications: WB
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
MAB46941
Species: Hu
Applications: WB, IHC
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NBP2-02158
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: WB
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003420-D01P
Species: Hu
Applications: WB

Publications for IDH3B Antibody (H00003420-D01P) (0)

There are no publications for IDH3B Antibody (H00003420-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for IDH3B Antibody (H00003420-D01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00003420-D01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot IDH3B H00003420-D01P
Enlarge
reviewed by:
Hongxia Hu
WB Human 08/24/2010
View

Summary

ApplicationWestern Blot
Sample TestedHCT116 whole cell lysate, Sample Amount: 70ug
SpeciesHuman

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in TBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: donkey anti-rabbit HRP conjugated, Secondary Ab Dilution Ratio: 1:5000

Details

Detection NotesDetection Method: ECL Plus, Exposure Time: 5 minutes, Specific Bands: ~44 kDa, Non-Specific Bands: ~60KDa and ~90kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IDH3B Antibody (H00003420-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IDH3B Products

Bioinformatics Tool for IDH3B Antibody (H00003420-D01P)

Discover related pathways, diseases and genes to IDH3B Antibody (H00003420-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDH3B Antibody (H00003420-D01P)

Discover more about diseases related to IDH3B Antibody (H00003420-D01P).
 

Pathways for IDH3B Antibody (H00003420-D01P)

View related products by pathway.

PTMs for IDH3B Antibody (H00003420-D01P)

Learn more about PTMs related to IDH3B Antibody (H00003420-D01P).

Blogs on IDH3B

There are no specific blogs for IDH3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Hongxia Hu
08/24/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol IDH3B
Entrez
Uniprot