IDH3A Antibody - BSA Free

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Analysis in human heart muscle and liver tissues using NBP1-85840 antibody. Corresponding IDH3A RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: IDH3A Antibody [NBP1-85840] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Staining of human Heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Staining of human Liver shows very weak granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.

Analysis in human cell line U-251 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IDH3A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH3A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IDH3A Protein (NBP1-85840PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IDH3A Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.41
• H-IDH alpha
• isocitrate dehydrogenase (NAD+) alpha chain
• isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
• isocitrate dehydrogenase 3 (NAD+) alpha
• Isocitric dehydrogenase subunit alpha
• NAD(+)-specific ICDH subunit alpha
• NAD(H)-specific isocitrate dehydrogenase alpha subunit
• NAD+-specific ICDH

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IDH3A