IDH3A Antibody


Western Blot: IDH3A Antibody [NBP1-85840] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: IDH3A Antibody [NBP1-85840] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-85840] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: IDH3A Antibody [NBP1-85840] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

IDH3A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV
Specificity of human, mouse, rat IDH3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IDH3A Protein (NBP1-85840PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IDH3A Antibody

  • EC 1.1.1
  • EC
  • H-IDH alpha
  • isocitrate dehydrogenase (NAD+) alpha chain
  • isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
  • isocitrate dehydrogenase 3 (NAD+) alpha
  • Isocitric dehydrogenase subunit alpha
  • NAD(+)-specific ICDH subunit alpha
  • NAD(H)-specific isocitrate dehydrogenase alpha subunit
  • NAD+-specific ICDH


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ze
Applications: WB, ChIP, ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IDH3A Antibody (NBP1-85840) (0)

There are no publications for IDH3A Antibody (NBP1-85840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IDH3A Antibody (NBP1-85840) (0)

There are no reviews for IDH3A Antibody (NBP1-85840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IDH3A Antibody (NBP1-85840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IDH3A Products

Bioinformatics Tool for IDH3A Antibody (NBP1-85840)

Discover related pathways, diseases and genes to IDH3A Antibody (NBP1-85840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDH3A Antibody (NBP1-85840)

Discover more about diseases related to IDH3A Antibody (NBP1-85840).

Pathways for IDH3A Antibody (NBP1-85840)

View related products by pathway.

PTMs for IDH3A Antibody (NBP1-85840)

Learn more about PTMs related to IDH3A Antibody (NBP1-85840).

Research Areas for IDH3A Antibody (NBP1-85840)

Find related products by research area.

Blogs on IDH3A

There are no specific blogs for IDH3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IDH3A Antibody and receive a gift card or discount.


Gene Symbol IDH3A