ID2 Antibody


Western Blot: ID2 Antibody [NBP1-88630] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunocytochemistry: ID2 Antibody [NBP1-88630] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ID2 Antibody [NBP1-88630] - Staining of human duodenum shows strong granular positivity in glandular cells.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

ID2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
ID2 Protein (NBP1-88630PEP)
Read Publications using
NBP1-88630 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23063798)

Alternate Names for ID2 Antibody

  • BHLHB26
  • bHLHb26cell growth-inhibiting gene 8
  • Class B basic helix-loop-helix protein 26
  • DNA-binding protein inhibitor ID2
  • DNA-binding protein inhibitor ID-2
  • GIG8
  • helix-loop-helix protein ID2
  • ID2A
  • ID2H
  • inhibitor of differentiation 2
  • Inhibitor of DNA binding 2
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • MGC26389


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ID2 Antibody (NBP1-88630)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ID2 Antibody (NBP1-88630) (0)

There are no reviews for ID2 Antibody (NBP1-88630). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID2 Antibody (NBP1-88630). (Showing 1 - 1 of 1 FAQs).

  1. Why there are 2 dominantly expressed bands in the Western Blot? Are there 2 different constructs used for expression in the HEK cells? Has the antibody been tested with endogenous ID2?
    • The ID2 overexpression lysate used for the western blot image of NBP1-88630 was NBL1-11814, which is supplied to us by a collaborator lab. As far as we know, there is only one construct expressing the ID2 protein. Since there are no bands in the negative control, we think that both bands detected in the lysate overexpressing the ID2 protein represent the target. I am sorry, but we have not investigated the identity of the two bands. Perhaps the lower band is a partially degraded version. We have received reports that NBP1-88630 has been successfully used in western blot with endogenous cell samples, although unfortunately we do not have the actual data. Nevertheless, the ICC/IF and IHC-P images for this antibody demonstrate that it can detect the endogenous protein.

Secondary Antibodies


Isotype Controls

Additional ID2 Antibody Products

Related Products by Gene

Bioinformatics Tool for ID2 Antibody (NBP1-88630)

Discover related pathways, diseases and genes to ID2 Antibody (NBP1-88630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID2 Antibody (NBP1-88630)

Discover more about diseases related to ID2 Antibody (NBP1-88630).

Pathways for ID2 Antibody (NBP1-88630)

View related products by pathway.

PTMs for ID2 Antibody (NBP1-88630)

Learn more about PTMs related to ID2 Antibody (NBP1-88630).

Research Areas for ID2 Antibody (NBP1-88630)

Find related products by research area.

Blogs on ID2

There are no specific blogs for ID2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol ID2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88630 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought