ID2 Antibody


Immunocytochemistry/ Immunofluorescence: ID2 Antibody [NBP1-88630] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

ID2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:8000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB and IHC reported in the literature (PMID: 23063798).
Control Peptide
ID2 Protein (NBP1-88630PEP)
Read Publications using
NBP1-88630 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID: 23063798).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ID2 Antibody

  • BHLHB26
  • bHLHb26cell growth-inhibiting gene 8
  • Class B basic helix-loop-helix protein 26
  • DNA-binding protein inhibitor ID2
  • DNA-binding protein inhibitor ID-2
  • GIG8
  • helix-loop-helix protein ID2
  • ID2
  • ID2A
  • ID2H
  • inhibitor of differentiation 2
  • Inhibitor of DNA binding 2
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • MGC26389


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ID2 Antibody (NBP1-88630)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ID2 Antibody (NBP1-88630) (0)

There are no reviews for ID2 Antibody (NBP1-88630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID2 Antibody (NBP1-88630). (Showing 1 - 1 of 1 FAQs).

  1. Why there are 2 dominantly expressed bands in the Western Blot? Are there 2 different constructs used for expression in the HEK cells? Has the antibody been tested with endogenous ID2?
    • The ID2 overexpression lysate used for the western blot image of NBP1-88630 was NBL1-11814, which is supplied to us by a collaborator lab. As far as we know, there is only one construct expressing the ID2 protein. Since there are no bands in the negative control, we think that both bands detected in the lysate overexpressing the ID2 protein represent the target. I am sorry, but we have not investigated the identity of the two bands. Perhaps the lower band is a partially degraded version. We have received reports that NBP1-88630 has been successfully used in western blot with endogenous cell samples, although unfortunately we do not have the actual data. Nevertheless, the ICC/IF and IHC-P images for this antibody demonstrate that it can detect the endogenous protein.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ID2 Products

Bioinformatics Tool for ID2 Antibody (NBP1-88630)

Discover related pathways, diseases and genes to ID2 Antibody (NBP1-88630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID2 Antibody (NBP1-88630)

Discover more about diseases related to ID2 Antibody (NBP1-88630).

Pathways for ID2 Antibody (NBP1-88630)

View related products by pathway.

PTMs for ID2 Antibody (NBP1-88630)

Learn more about PTMs related to ID2 Antibody (NBP1-88630).

Research Areas for ID2 Antibody (NBP1-88630)

Find related products by research area.

Blogs on ID2

There are no specific blogs for ID2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ID2 Antibody and receive a gift card or discount.


Gene Symbol ID2