ID2 Antibody

Images

 
Western Blot: ID2 Antibody [NBP1-88630] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry: ID2 Antibody [NBP1-88630] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ID2 Antibody [NBP1-88630] - Staining of human duodenum shows strong granular positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related ID2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88630
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ID2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ID2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP1-88630 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23063798)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ID2 Antibody

  • BHLHB26
  • bHLHb26cell growth-inhibiting gene 8
  • Class B basic helix-loop-helix protein 26
  • DNA-binding protein inhibitor ID2
  • DNA-binding protein inhibitor ID-2
  • GIG8
  • helix-loop-helix protein ID2
  • ID2
  • ID2A
  • ID2H
  • inhibitor of differentiation 2
  • Inhibitor of DNA binding 2
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • MGC26389

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ID2 Antibody (NBP1-88630)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ID2 Antibody (NBP1-88630) (0)

There are no reviews for ID2 Antibody (NBP1-88630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID2 Antibody (NBP1-88630). (Showing 1 - 1 of 1 FAQs).

  1. Why there are 2 dominantly expressed bands in the Western Blot? Are there 2 different constructs used for expression in the HEK cells? Has the antibody been tested with endogenous ID2?
    • The ID2 overexpression lysate used for the western blot image of NBP1-88630 was NBL1-11814, which is supplied to us by a collaborator lab. As far as we know, there is only one construct expressing the ID2 protein. Since there are no bands in the negative control, we think that both bands detected in the lysate overexpressing the ID2 protein represent the target. I am sorry, but we have not investigated the identity of the two bands. Perhaps the lower band is a partially degraded version. We have received reports that NBP1-88630 has been successfully used in western blot with endogenous cell samples, although unfortunately we do not have the actual data. Nevertheless, the ICC/IF and IHC-P images for this antibody demonstrate that it can detect the endogenous protein.

Secondary Antibodies

 

Isotype Controls

Additional ID2 Products

Bioinformatics Tool for ID2 Antibody (NBP1-88630)

Discover related pathways, diseases and genes to ID2 Antibody (NBP1-88630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID2 Antibody (NBP1-88630)

Discover more about diseases related to ID2 Antibody (NBP1-88630).
 

Pathways for ID2 Antibody (NBP1-88630)

View related products by pathway.

PTMs for ID2 Antibody (NBP1-88630)

Learn more about PTMs related to ID2 Antibody (NBP1-88630).
 

Research Areas for ID2 Antibody (NBP1-88630)

Find related products by research area.

Blogs on ID2

There are no specific blogs for ID2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ID2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ID2
Entrez