ICAT/CTNNBIP1 Antibody (3B3) - Azide and BSA Free

Sandwich ELISA: ICAT/CTNNBIP1 Antibody (3B3) [H00056998-M03] - Detection limit for recombinant GST tagged CTNNBIP1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ICAT/CTNNBIP1 Antibody (3B3) - Azide and BSA Free Summary

• Immunogen: CTNNBIP1 (NP_064633, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CTNNBIP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ICAT/CTNNBIP1 Antibody (3B3) - Azide and BSA Free

• beta-catenin-interacting protein ICAT
• catenin, beta interacting protein 1
• CTNNBIP1
• ICAT
• ICATbeta-interacting protein 1
• Inhibitor of beta-catenin and Tcf-4

Background

The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNBIP1
• Uniprot:
  • NP_064633(Human)