iASPP Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL |
| Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP1R13L |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for iASPP Antibody - BSA Free
Background
ASPP proteins (ASPP1, ASPP2 and iASPP) represent a new family of p53 binding proteins. ASPP1 and ASPP2 bind and enhance p53-mediated apoptosis. In contrast, the third member, iASPP, functionally inactivates p53. iASPP (also called protein phosphatase 1 regulatory (inhibitor) subunit 13 like protein, Inhibitor of ASPP protein, Protein iASPP, PPP1R13B-like protein and NFkB-interacting protein 1) plays a central role in regulation of apoptosis and transcription via its interaction with NF-kappa-B and p53/TP53 proteins. iASPP blocks transcription of HIV-1 virus by inhibiting the action of both NF-kappa-B and SP1. This protein also inhibits p53/TP53 function, possibly by preventing the association between p53/TP53 and ASPP1 or ASPP2, and therefore suppressing the subsequent activation of apoptosis. iASPP is predominantly a cytoplasmic protein (isoform 1) but can also be found in the nucleus (isoform 2). iASPP is highly expressed in heart, placenta and prostate and is weakly expressed in brain, liver, skeletal muscle, testis and peripheral blood leukocyte. The N-terminal region of isoform 1 is required for cytoplasmic localization. Defects in iASPP may be a cause of certain breast cancers and the protein is overexpressed in many patients suffering from breast carcinomas and expressing a wild-type p53/TP53 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Publications for iASPP Antibody (NBP2-38879) (0)
There are no publications for iASPP Antibody (NBP2-38879).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for iASPP Antibody (NBP2-38879) (0)
There are no reviews for iASPP Antibody (NBP2-38879).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for iASPP Antibody (NBP2-38879) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional iASPP Products
Research Areas for iASPP Antibody (NBP2-38879)
Find related products by research area.
|
Blogs on iASPP