HUNK Antibody (2G6) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse HUNK Antibody (2G6) - Azide and BSA Free (H00030811-M05) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
HUNK (NP_055401, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC |
| Specificity |
HUNK (2G6) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HUNK |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HUNK Antibody (2G6) - Azide and BSA Free
Background
HUNK, an AMPK/SNF1-type protein kinase, contains a domain homologous to SNF1, a protein involved in the response to nutritional stress in yeast. HUNK has been shown to participate in vesicular transport. Additionally, functional studies in mice suggest that HUNK regulates endocytosis via interaction with rabaptin-5 protein and induces changes in mammary glands during pregnancy. HUNK expression has been documented in mouse brain, breast, embryo, and fetus. ESTs have been isolated from several human tissue libraries, including normal ear.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ELISA
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for HUNK Antibody (H00030811-M05) (0)
There are no publications for HUNK Antibody (H00030811-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HUNK Antibody (H00030811-M05) (0)
There are no reviews for HUNK Antibody (H00030811-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HUNK Antibody (H00030811-M05) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HUNK Products
Research Areas for HUNK Antibody (H00030811-M05)
Find related products by research area.
|
Blogs on HUNK