HtrA3 Antibody - BSA Free

Western Blot: HtrA3 Antibody [NBP2-87609] - WB Suggested Anti-HTRA3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HtrA3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HtrA3 Antibody - BSA Free (NBP2-87609) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of HtrA3. Peptide sequence: TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTRA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HtrA3 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.108
• High-temperature requirement factor A3
• HTRA 3
• HtrA serine peptidase 3
• HTRA3
• Pregnancy-related serine protease
• probable serine protease HTRA3
• Prsp
• serine protease HTRA3
• Tasp

Background

HtrA3 belongs to the human high-temperature requirement factor A (HtrA) family. HtrA3 has two isoforms (long and short), which are produced by alternative splicing. Similar to HtrA1, HtrA3 binds to various TGF-beta proteins and inhibits the signaling of BMP-4, -2 and TGF-beta 1. HtrA3 does not inhibit signaling originated from a constitutively active BMP receptor, indicating that the inhibition occurs upstream of the cell surface receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTRA3